9FQ2: Poliovirus 3C protease in H32 spacegroup

Poliovirus 3C protease in H32 spacegroup. Determined by X-ray diffraction at 2.37 Å resolution. Released 26 Jun 2024.

Method: X-ray diffraction
Resolution: 2.37 Å
Organism: Poliovirus 1
Chains: 2
Atoms: 2,746
Mol. weight: 39.29 kDa
Released: 26 Jun 2024

Explore 9FQ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FQ2 contains 7 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-78	10	1
β-strand	83	1	2
β-strand	97-104	8	3
β-strand	112-126	15	3
β-strand	131-139	9	3
β-strand	150-153	4	3
β-strand	156-164	9	3
β-strand	168-173	6	3
α-helix	176-178	3

Chain B: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	15-19	5	4
β-strand	24-31	8	4
β-strand	32	1	5
β-strand	34-38	5	4
α-helix	39-41	3
β-strand	46-49	4	4
β-strand	52-63	12	4
β-strand	69-77	9	4
β-strand	83	1	5
α-helix	84-85	2
β-strand	97-104	8	3
β-strand	112-125	14	3
β-strand	132-138	7	3
β-strand	150-152	3	3
β-strand	157-164	8	3
β-strand	169-173	5	3
α-helix	176-179	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protease 3C	A, B	protein	183	Poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9FQ2_1 Protease 3C (chains A, B)
GPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGESIVIDGKEVEILDAK
ALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLIVNTSKYPNMYVPVGAVT
EQGYLNLGGRQTARTLMYNFPTRAGQCGGVITCTGKVIGMHVGGNGSHGFAAALKRSYFT
QSQ

Primary citation

Poliovirus 3C protease in H32 spacegroup. Fairhead, M., Lithgo, R.M., MacLean, E.M. et al. To be published.

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
1L1N 2.1 Å, Poliovirus 3C proteinase
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
1HXS 2.2 Å, Crystal structure of mahoney strain of poliovirus at 2.2A resolution
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
2IM0 2.25 Å, Crystal structure of poliovirus polymerase complexed with CTP and Mg2+

Browse structure collections

About this viewer

MolViewer shows 9FQ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.