9G0L: RING-ZnF1 fragment of SIAH1

Crystal structure of the RING-ZnF1 fragment of SIAH1. Determined by X-ray diffraction at 1.9 Å resolution. Released 19 Feb 2025.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 806
Mol. weight: 12.14 kDa
Ligands: ZN
Released: 19 Feb 2025

Explore 9G0L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9G0L contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	32-37	6
β-strand	40	1	1
β-strand	47	1	1
α-helix	52	1
β-strand	53-54	2	2
β-strand	60	1	2
α-helix	66-68	3
β-strand	82-83	2	2
α-helix	85-91	7
α-helix	95	1
β-strand	96-97	2	3
α-helix	98	1
α-helix	101-103	3
β-strand	108-109	2	3
α-helix	111-120	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SIAH1	A	protein	107	Homo sapiens	Q8IUQ4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9G0L_1 E3 ubiquitin-protein ligase SIAH1 (chains A)
MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLA
MEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

RING dimerisation drives higher-order organisation of SINA/SIAH E3 ubiquitin ligases. Coste, F., Mishra, A., Chapuis, C. et al. FEBS J (2025) 292:2784-2805. DOI 10.1111/febs.70000 · PubMed

Other PDB entries of the same protein (UniProt Q8IUQ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CA1 1.58 Å, Crystal structure of Siah1 at 1.58 A resolution.
4C9Z 1.95 Å, Crystal structure of Siah1 at 1.95 A resolution
5WZZ 2.1 Å, The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating…
2A25 2.2 Å, Crystal structure of Siah1 SBD bound to the peptide EKPAAVVAPITTG from SIP
4X3G 2.34 Å, Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
4I7D 2.4 Å, Siah1 bound to synthetic peptide (ACE)KLRPVAMVRP(PRK)VR
8HEO 2.53 Å, Crystal structure of SIAH1 SBD bound to Axin2 peptide
4I7C 2.8 Å, Siah1 mutant bound to synthetic peptide (ACE)KLRPV(23P)MVRPWVR
4I7B 3.0 Å, Siah1 bound to synthetic peptide (ACE)KLRPV(ABA)MVRPTVR

Browse structure collections

About this viewer

MolViewer shows 9G0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.