9GC0: 3'-lobe of the substrate-bound U11 snRNP
3'-lobe of the substrate-bound U11 snRNP. Determined by electron microscopy at 3.2 Å resolution. Released 5 Feb 2025.
- Method
- Electron microscopy
- Resolution
- 3.2 Å
- Organism
- Homo sapiens
- Chains
- 11
- Atoms
- 8,297
- Mol. weight
- 252.85 kDa
- Released
- 5 Feb 2025
Explore 9GC0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9GC0 contains 40 α-helices and 55 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain D: 9 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 172-197 | 26 | |
| α-helix | 198-200 | 3 | |
| α-helix | 202-223 | 22 | |
| α-helix | 224-228 | 5 | |
| α-helix | 235-254 | 20 | |
| α-helix | 255-259 | 5 | |
| α-helix | 260-278 | 19 | |
| α-helix | 279-283 | 5 | |
| α-helix | 284-285 | 2 | |
Chain E: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 1 |
| β-strand | 13-14 | 2 | 1 |
| α-helix | 18-25 | 8 | |
| α-helix | 28-40 | 13 | |
Chain F: 11 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-31 | 24 | |
| β-strand | 55-57 | 3 | 7 |
| β-strand | 65-67 | 3 | 7 |
| α-helix | 68-82 | 15 | |
| α-helix | 87-92 | 6 | |
| α-helix | 96-100 | 5 | |
| β-strand | 107-109 | 3 | 6 |
| α-helix | 112-129 | 18 | |
| α-helix | 132-136 | 5 | |
| α-helix | 144-146 | 3 | |
| α-helix | 149-155 | 7 | |
| α-helix | 158-177 | 20 | |
| α-helix | 238-256 | 19 | |
Chain h: 3 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-8 | 6 | |
| β-strand | 14-19 | 6 | 2 |
| β-strand | 24-28 | 5 | 2 |
| β-strand | 29-32 | 4 | 3 |
| β-strand | 38-40 | 3 | 3 |
| β-strand | 43-46 | 4 | 2 |
| β-strand | 52-55 | 4 | 2 |
| β-strand | 58-60 | 3 | 3 |
| α-helix | 62-64 | 3 | |
| β-strand | 65-69 | 5 | 2 |
| α-helix | 76-79 | 4 | |
Chain i: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-26 | 7 | |
| α-helix | 30-38 | 9 | |
| β-strand | 41-46 | 6 | 2 |
| β-strand | 51-59 | 9 | 2 |
| β-strand | 65-76 | 12 | 2 |
| β-strand | 90-101 | 12 | 2 |
| α-helix | 103-105 | 3 | |
| β-strand | 106-111 | 6 | 2 |
Chain j: 4 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-12 | 8 | |
| β-strand | 17 | 1 | 4 |
| β-strand | 19-22 | 4 | 3 |
| β-strand | 27-28 | 2 | 3 |
| α-helix | 30 | 1 | |
| β-strand | 31-35 | 5 | 4 |
| β-strand | 41-44 | 4 | 4 |
| β-strand | 48-49 | 2 | 3 |
| β-strand | 55-56 | 2 | 3 |
| β-strand | 61-63 | 3 | 4 |
| α-helix | 65-67 | 3 | |
| β-strand | 68-72 | 5 | 3 |
| α-helix | 75-79 | 5 | |
Chain k: 2 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-10 | 4 | |
| β-strand | 16-21 | 6 | 3 |
| β-strand | 26-34 | 9 | 3 |
| β-strand | 40-50 | 11 | 3 |
| β-strand | 55 | 1 | 5 |
| β-strand | 58 | 1 | 5 |
| β-strand | 62-72 | 11 | 3 |
| α-helix | 74-76 | 3 | |
| β-strand | 77-82 | 6 | 3 |
Chain l: 2 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-27 | 11 | |
| β-strand | 30-35 | 6 | 2 |
| β-strand | 41-49 | 9 | 2 |
| β-strand | 57-65 | 9 | 2 |
| β-strand | 70 | 1 | 2 |
| β-strand | 73 | 1 | 2 |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 81-83 | 3 | |
| β-strand | 84-88 | 5 | 2 |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Zinc finger matrin-type protein 5 | E | protein | 170 | Homo sapiens | Q9UDW3 (AlphaFold model) |
| Programmed cell death protein 7 | D | protein | 485 | Homo sapiens | Q8N8D1 (AlphaFold model) |
| Small nuclear ribonucleoprotein Sm D1 | h | protein | 119 | Homo sapiens | P62314 (AlphaFold model) |
| Small nuclear ribonucleoprotein Sm D3 | j | protein | 126 | Homo sapiens | P62318 (AlphaFold model) |
| Small nuclear ribonucleoprotein-associated proteins B and B' | k | protein | 240 | Homo sapiens | P14678 |
| Small nuclear ribonucleoprotein E | l | protein | 92 | Homo sapiens | P62304 |
| Small nuclear ribonucleoprotein F | m | protein | 86 | Homo sapiens | P62306 |
| Small nuclear ribonucleoprotein G | n | protein | 76 | Homo sapiens | P62308 |
| U11 snRNA | Q | RNA | 135 | Homo sapiens | |
| U11/U12 small nuclear ribonucleoprotein 48 kDa protein | F | protein | 339 | Homo sapiens | Q6IEG0 |
| Small nuclear ribonucleoprotein Sm D2 | i | protein | 118 | Homo sapiens | P62316 |
Sequence of entity 1 (E), FASTA
>9GC0_1 Zinc finger matrin-type protein 5 (chains E)
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKR
LSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
Sequence of entity 2 (D), FASTA
>9GC0_2 Programmed cell death protein 7 (chains D)
MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPL
ALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPGTDAGERPRPPPPGPGPPWSP
RWPEAPPPPADVLGDAALQRLRDRQWLEAVFGTPRRAGCPVPQRTHAGPSLGEVRARLLR
ALRLVRRLRGLSQALREAEADGAAWVLLYSQTAPLRAELAERLQPLTQAAYVGEARRRLE
RVRRRRLRLRERAREREAEREAEAARAVEREQEIDRWRVKCVQEVEEKKREQELKAAADG
VLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRLRKLIK
KRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPL
AHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
AVKLH
Sequence of entity 3 (h), FASTA
>9GC0_3 Small nuclear ribonucleoprotein Sm D1 (chains h)
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
Sequence of entity 4 (j), FASTA
>9GC0_4 Small nuclear ribonucleoprotein Sm D3 (chains j)
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ
VYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGN
IFQKRR
Sequence of entity 5 (k), FASTA
>9GC0_5 Small nuclear ribonucleoprotein-associated proteins B and B' (chains k)
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
Sequence of entity 6 (l), FASTA
>9GC0_6 Small nuclear ribonucleoprotein E (chains l)
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
Sequence of entity 7 (m), FASTA
>9GC0_7 Small nuclear ribonucleoprotein F (chains m)
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
Sequence of entity 8 (n), FASTA
>9GC0_8 Small nuclear ribonucleoprotein G (chains n)
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV
Sequence of entity 9 (Q), FASTA
>9GC0_9 U11 snRNA (chains Q)
AAAAAGGGCUUCUGUCGUGAGUGGCACACGUAGGGCAACUCGAUUGCUCUGCGUGCGGAA
UCGACAUCAAGAGAUUUCGGAAGCAUAAUUUUUUGGUAUUUGGGCAGCUGGUGAUCGUUG
GUCCCGGCGCCCUUU
Sequence of entity 10 (F), FASTA
>9GC0_10 U11/U12 small nuclear ribonucleoprotein 48 kDa protein (chains F)
MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPY
DSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIK
QARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQ
IIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEV
IRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRS
RSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI
Sequence of entity 11 (i), FASTA
>9GC0_11 Small nuclear ribonucleoprotein Sm D2 (chains i)
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
Primary citation
Structural basis of 5' splice site recognition by the minor spliceosome. Zhao, J., Peter, D., Brandina, I. et al. Mol Cell (2025) 85:652. DOI 10.1016/j.molcel.2024.12.017 · PubMed
Other PDB entries of the same protein (UniProt Q9UDW3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9GCL 3.0 Å, Structure of the U11 snRNP C-lobe
- 8Y6O 3.38 Å, Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U11…
- 8R7N 3.4 Å, Overall structure of the U11 snRNP
- 9GBW 3.5 Å, Overall structure of the substrate-bound U11 snRNP
Browse structure collections
About this viewer
MolViewer shows 9GC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.