9GCG: Human INO80 core- H2A.Z nucleosome complex

CryoEM structure of the human INO80 core- H2A.Z nucleosome complex. Determined by electron microscopy at 3.43 Å resolution. Released 13 Aug 2025.

Method: Electron microscopy
Resolution: 3.43 Å
Organisms: Homo sapiens, synthetic construct
Chains: 20
Atoms: 43,164
Mol. weight: 814.73 kDa
Ligands: ADP, ZN, ATP
Released: 13 Aug 2025

Explore 9GCG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GCG contains 263 α-helices and 228 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	15	1	22
β-strand	26	1	23
α-helix	31	1
β-strand	32	1	23
α-helix	33	1
β-strand	35-36	2	24
β-strand	39-40	2	24
α-helix	43-57	15
β-strand	65-69	5	25
α-helix	76-87	12
β-strand	93-97	5	25
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-140	21	26
β-strand	157-163	7	26
β-strand	166-172	7	26
α-helix	174-182	9
β-strand	189-194	6	26
β-strand	199-206	8	26
α-helix	207-209	3
β-strand	215	1	27
β-strand	220-221	2	26
α-helix	222-224	3
β-strand	229-239	11	26
α-helix	240-248	9
α-helix	250-251	2
α-helix	259-262	4
α-helix	273-288	16
β-strand	292-296	5	26
β-strand	298-302	5	25
α-helix	304-306	3
α-helix	309-318	10
β-strand	326-331	6	25
β-strand	333	1	28
α-helix	336	1
β-strand	337	1	29
α-helix	338	1
β-strand	345	1	29
α-helix	347-349	3
α-helix	352-355	4
β-strand	359-362	4	25
α-helix	365-367	3
α-helix	368-382	15
β-strand	385-386	2	30
α-helix	388-400	13
α-helix	403-419	17
β-strand	424-425	2	30
α-helix	427-436	10
β-strand	438	1	31
α-helix	440-449	10
α-helix	451-453	3

Chain B: 25 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	32
α-helix	10-14	5
β-strand	15	1	14
β-strand	26	1	33
α-helix	31	1
β-strand	32	1	33
α-helix	33	1
β-strand	35-36	2	34
β-strand	39-40	2	34
α-helix	43-57	15
β-strand	61	1	35
β-strand	65-69	5	36
α-helix	76-86	11
β-strand	93-97	5	36
α-helix	108-118	11
β-strand	120-143	24	37
β-strand	153-163	11	37
β-strand	166-172	7	37
α-helix	174-182	9
β-strand	189-194	6	37
β-strand	199-206	8	37
α-helix	207-209	3
β-strand	215	1	6
β-strand	220-221	2	37
α-helix	222-225	4
β-strand	229-239	11	37
α-helix	240-248	9
α-helix	256-260	5
α-helix	273-288	16
β-strand	292-296	5	37
β-strand	298-302	5	36
α-helix	304-306	3
α-helix	309-318	10
β-strand	326-331	6	36
β-strand	333	1	38
α-helix	336	1
β-strand	337	1	39
α-helix	338	1
β-strand	345	1	39
α-helix	347-349	3
α-helix	352-355	4
β-strand	359-362	4	36
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	40
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	40
α-helix	427-436	10
β-strand	438	1	15
α-helix	442-449	8

Chain C: 29 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	15	1	1
β-strand	26	1	2
α-helix	31	1
β-strand	32	1	2
α-helix	33	1
β-strand	35-36	2	3
β-strand	39-40	2	3
α-helix	43-57	15
β-strand	61	1	4
β-strand	65-69	5	5
α-helix	76-87	12
β-strand	93-97	5	5
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-142	23	6
α-helix	146	1
β-strand	152-163	12	6
β-strand	166-172	7	6
α-helix	176-182	7
β-strand	187	1	6
β-strand	189-194	6	6
β-strand	200-205	6	6
β-strand	206	1	7
α-helix	207-209	3
β-strand	221	1	7
α-helix	222-224	3
β-strand	229-239	11	6
α-helix	240-248	9
α-helix	256-263	8
α-helix	265-266	2
α-helix	273-288	16
β-strand	292-296	5	6
β-strand	298-302	5	5
α-helix	304-306	3
α-helix	309-318	10
β-strand	326-331	6	5
β-strand	333	1	8
α-helix	336	1
β-strand	337	1	9
α-helix	338	1
β-strand	345	1	9
α-helix	347-349	3
α-helix	352-355	4
β-strand	359-362	4	5
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	10
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	10
α-helix	427-436	10
β-strand	438	1	11
α-helix	440-448	9
α-helix	451-453	3

Chain D: 21 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	35
β-strand	42-43	2	41
β-strand	46-47	2	41
α-helix	50-65	16
β-strand	68	1	22
β-strand	71-76	6	31
α-helix	85-93	9
β-strand	100-104	5	31
α-helix	105-107	3
α-helix	115-125	11
β-strand	128-146	19	27
β-strand	159-164	6	27
β-strand	169-174	6	27
α-helix	176-184	9
β-strand	191-196	6	27
β-strand	201-208	8	27
α-helix	209-211	3
β-strand	224-225	2	27
α-helix	226-229	4
β-strand	233-243	11	27
α-helix	244-250	7
α-helix	256-258	3
α-helix	259-262	4
α-helix	270-285	16
β-strand	290-292	3	27
β-strand	295-299	5	31
α-helix	301-303	3
α-helix	306-315	10
β-strand	323-328	6	31
β-strand	333-334	2	42
α-helix	335	1
β-strand	341-342	2	42
α-helix	343-345	3
α-helix	348-351	4
β-strand	354-358	5	31
α-helix	364-378	15
β-strand	382	1	43
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	43
α-helix	423-432	10
β-strand	434	1	36
α-helix	436-444	9
β-strand	451	1	38

Chain E: 22 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	4
β-strand	33	1	12
α-helix	38	1
β-strand	39	1	12
α-helix	40	1
β-strand	42-43	2	13
β-strand	46-47	2	13
α-helix	50-65	16
β-strand	68	1	14
β-strand	72-76	5	15
α-helix	83-93	11
β-strand	100-104	5	15
α-helix	105-108	4
α-helix	115-124	10
β-strand	127-150	24	6
β-strand	158-164	7	6
β-strand	169-174	6	6
α-helix	179-184	6
β-strand	191-196	6	6
β-strand	201-207	7	6
β-strand	208	1	16
α-helix	211-213	3
β-strand	225	1	16
α-helix	226-228	3
β-strand	233-243	11	6
α-helix	244-251	8
α-helix	259-262	4
α-helix	270-286	17
β-strand	290-293	4	6
β-strand	295-299	5	15
α-helix	301-303	3
α-helix	306-315	10
β-strand	323-328	6	15
β-strand	333-334	2	17
α-helix	335	1
β-strand	341-342	2	17
α-helix	343-345	3
α-helix	348-351	4
β-strand	355-358	4	15
α-helix	364-377	14
β-strand	382	1	18
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	18
α-helix	423-432	10
β-strand	434	1	5
α-helix	436-445	10
β-strand	451	1	8

Chain F: 24 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	44
α-helix	38	1
β-strand	39	1	44
α-helix	40	1
β-strand	42-43	2	45
β-strand	46-47	2	45
α-helix	50-65	16
β-strand	68	1	1
β-strand	72-76	5	11
α-helix	83-94	12
β-strand	100-104	5	11
α-helix	105-108	4
α-helix	115-124	10
β-strand	127-136	10	46
β-strand	138-148	11	47
β-strand	158-165	8	47
β-strand	168-172	5	47
α-helix	176-184	9
β-strand	191-195	5	47
β-strand	202-208	7	47
α-helix	209-211	3
β-strand	217	1	26
β-strand	224-225	2	47
α-helix	226-228	3
β-strand	235-243	9	46
α-helix	244-250	7
α-helix	258-262	5
α-helix	270-286	17
β-strand	289-293	5	46
β-strand	295-299	5	11
α-helix	301-303	3
α-helix	306-315	10
β-strand	323-328	6	11
β-strand	333-334	2	48
α-helix	335	1
β-strand	341-342	2	48
α-helix	343-345	3
α-helix	348-351	4
β-strand	356-358	3	11
α-helix	361-363	3
α-helix	364-377	14
β-strand	382	1	49
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	49
α-helix	423-432	10
β-strand	434	1	25
α-helix	436-445	10
α-helix	447-449	3
β-strand	451	1	28

Chain G: 46 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	520-535	16
β-strand	539-540	2	50
β-strand	541	1	51
α-helix	543-544	2
α-helix	549-558	10
β-strand	570-574	5	50
α-helix	576-578	3
α-helix	579-589	11
β-strand	595-598	4	50
α-helix	602-611	10
β-strand	626-630	5	50
α-helix	631-634	4
α-helix	638-641	4
β-strand	648-651	4	50
α-helix	654-657	4
α-helix	663-668	6
β-strand	675-678	4	50
α-helix	688-698	11
α-helix	708-711	4
α-helix	730-739	10
β-strand	744	1	51
α-helix	748-751	4
α-helix	756-758	3
β-strand	759-765	7	32
α-helix	769-779	11
α-helix	809-817	9
α-helix	819-821	3
α-helix	824-826	3
β-strand	828	1	52
β-strand	831-833	3	53
α-helix	835-837	3
β-strand	838-839	2	54
α-helix	842-847	6
α-helix	850-853	4
α-helix	855-863	9
α-helix	869-877	9
α-helix	889-892	4
α-helix	898-906	9
α-helix	909-932	24
α-helix	944-945	2
α-helix	959-964	6
α-helix	968-971	4
β-strand	980-989	10	6
β-strand	996-1005	10	6
α-helix	1006-1007	2
α-helix	1008-1010	3
β-strand	1017-1019	3	53
α-helix	1020-1022	3
β-strand	1024-1025	2	54
α-helix	1029-1040	12
α-helix	1044-1052	9
α-helix	1055-1061	7
α-helix	1064-1066	3
α-helix	1070-1073	4
α-helix	1076-1078	3
β-strand	1089	1	52
α-helix	1095-1098	4
α-helix	1101-1116	16
β-strand	1120-1123	4	32
α-helix	1127-1139	13
β-strand	1144-1147	4	32
α-helix	1153-1163	11
β-strand	1171-1174	4	32
α-helix	1176-1179	4
β-strand	1190-1193	4	32
α-helix	1202-1208	7
β-strand	1220-1226	7	32
α-helix	1231-1247	17

Chain H: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	210-232	23
β-strand	272-277	6	6
β-strand	283-286	4	6
β-strand	297-298	2	6
α-helix	300-303	4
α-helix	306-307	2
β-strand	308	1	55
α-helix	316	1
β-strand	317	1	55
α-helix	318	1
β-strand	320-322	3	47
β-strand	328-329	2	47
α-helix	332-341	10

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like 1	A, B, C	protein	456	Homo sapiens	Q9Y265 (AlphaFold model)
RuvB-like 2	D, E, F	protein	463	Homo sapiens	Q9Y230 (AlphaFold model)
INO80 complex subunit C	I	protein	192	Homo sapiens	Q6PI98 (AlphaFold model)
Chromatin-remodeling ATPase INO80	G	protein	1556	Homo sapiens	Q9ULG1 (AlphaFold model)
INO80 complex subunit B	H	protein	356	Homo sapiens	Q9C086
Actin-related protein 5	J	protein	607	Homo sapiens	Q9H9F9
Nucleosomal DNA Strand 1 (152-MER)	K	DNA	152	synthetic construct
Nucleosomal DNA Strand 2 (152-MER)	L	DNA	152	synthetic construct
Histone H3.1	M, Q	protein	136	Homo sapiens	P68431
Histone H4	N, R	protein	102	Homo sapiens	P62805
Histone H2A.Z	O	protein	127	Homo sapiens	P0C0S5
Histone H2B type 2-E	P, T	protein	125	Homo sapiens	Q16778

1 more molecules are not listed.

Sequence of entity 1 (A, B, C), FASTA

>9GCG_1 RuvB-like 1 (chains A, B, C)
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK

Sequence of entity 2 (D, E, F), FASTA

>9GCG_2 RuvB-like 2 (chains D, E, F)
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTT
PYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Sequence of entity 3 (I), FASTA

>9GCG_3 INO80 complex subunit C (chains I)
MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMS
ENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKYLKQILASERALPW
QLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTG
YLALRKATSIVP

Sequence of entity 4 (G), FASTA

>9GCG_4 Chromatin-remodeling ATPase INO80 (chains G)
MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
LLPQSGDPLIQVKEEPPNSLLGETSGAGSSGMLNTYSLNGVLQSESKCDKGNLYNFSKLK
KSRKWLKSILLSDESSEADSQSEDDDEEELNLSREELHNMLRLHKYKKLHQNKYSKDKEL
QQYQYYSAGLLSTYDPFYEQQRHLLGPKKKKFKEEKKLKAKLKKVKKKRRRDEELSSEES
PRRHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKVWLSIVKKELPKANKQKASAR
NLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKYEKVEKEHRKR
AEKEALEQRKLDEEMREAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLED
SSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESRAAA
LRAANKSGTGFGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKGMNWLANLYEQGINGI
LADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWG
NPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALKSS
SSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIESH
AENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILMYCQLTSRQKLLYQALKN
KISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPYHI
SKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAE
MANLMLQGLLARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFP
NLCSCPLLKSLVFSSHCKAVSGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAV
PLDSYCNDRSAEYERRVLKEGGSLAAKQCLLNGAPELAADWLNRRSQFFPEPAGGLWSIR
PQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYMVYR
KHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNP
TVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPDTLK
PKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRK
EGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDM
LVIVDDPASSAPQSRATNSPASITGSVSDTVNGISIQEMPAAGRGHSARSRGRPKGSGST
AKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA
GLADFGPSSASSPLSSPLSKGNNVPGNPKNLHMTSSLAPDSLVRKQGKGTNPSGGR

Sequence of entity 5 (H), FASTA

>9GCG_5 INO80 complex subunit B (chains H)
MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPT
QPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYR
AWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQ
RALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIE
RLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQGSTLSFPPGVPAPTAVSQRP
SPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGSPLLAT

Sequence of entity 6 (J), FASTA

>9GCG_6 Actin-related protein 5 (chains J)
MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQ
FRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHL
GVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSM
CSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLS
RMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQ
QLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSY
IQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEET
PGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYP
KDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDW
ALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGG
GGAGEQA

Sequence of entity 7 (K), FASTA

>9GCG_7 Nucleosomal DNA Strand 1 (152-MER) (chains K)
CAATATCCCGAGTACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAG
TAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAG
AGCTGTCTACGACCAATTGAGCGGCCTCGGCA

Sequence of entity 8 (L), FASTA

>9GCG_8 Nucleosomal DNA Strand 2 (152-MER) (chains L)
TGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGC
TGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGAT
ATATACATCCTGTGCATGTACTCGGGATATTG

Sequence of entity 9 (M, Q), FASTA

>9GCG_9 Histone H3.1 (chains M, Q)
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA

Sequence of entity 10 (N, R), FASTA

>9GCG_10 Histone H4 (chains N, R)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Sequence of entity 11 (O), FASTA

>9GCG_11 Histone H2A.Z (chains O)
AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEY
LTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
KGQQKTV

Sequence of entity 12 (P, T), FASTA

>9GCG_12 Histone H2B type 2-E (chains P, T)
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMG
IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	7
ZN	Zinc ion	Zn	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Recognition and remodelling of nucleosomes and hexasomes by the human INO80 complex. Aggarwal, P., Sharma, M., Woike, S. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag138 · PubMed

Other PDB entries of the same protein (UniProt Q9Y265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C9O 2.2 Å, 3D Structure of the human RuvB-like helicase RuvBL1
8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9EMA 2.4 Å, RUVBL1/2 in complex with ATP and CB-6644 inhibitor
6K0R 2.5 Å, Ruvbl1-Ruvbl2 with truncated domain II in complex with phosphorylated Cordycepin
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
2XSZ 3.0 Å, The dodecameric human RuvBL1:RuvBL2 complex with truncated domains II
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
7ZI4 3.2 Å, Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex

Browse structure collections

About this viewer

MolViewer shows 9GCG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.