9GEV: Human INO80 core-nucleosome complex state N-6

CryoEM structure of the human INO80 core-nucleosome complex state N-6. Determined by electron microscopy at 3.47 Å resolution. Released 20 Aug 2025.

Method: Electron microscopy
Resolution: 3.47 Å
Organisms: Homo sapiens, synthetic construct
Chains: 20
Atoms: 42,875
Mol. weight: 815.41 kDa
Ligands: ATP, ADP
Released: 20 Aug 2025

Explore 9GEV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GEV contains 271 α-helices and 234 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	15	1	34
β-strand	26	1	35
α-helix	31	1
β-strand	32	1	35
α-helix	33	1
β-strand	35-36	2	36
β-strand	39-40	2	36
α-helix	43-57	15
β-strand	61	1	37
β-strand	65-69	5	38
α-helix	76-87	12
β-strand	93-97	5	38
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-140	21	39
β-strand	157-163	7	39
β-strand	166-172	7	39
α-helix	174-182	9
β-strand	189-194	6	39
β-strand	200-206	7	39
α-helix	207-209	3
β-strand	215	1	40
β-strand	220-221	2	39
α-helix	222-224	3
β-strand	229-239	11	39
α-helix	240-248	9
α-helix	250-251	2
α-helix	260-262	3
α-helix	273-287	15
β-strand	293-296	4	39
β-strand	298-302	5	38
α-helix	304-306	3
α-helix	309-318	10
β-strand	326-331	6	38
β-strand	333	1	41
α-helix	336	1
β-strand	337	1	42
α-helix	338	1
β-strand	345	1	42
α-helix	347-349	3
α-helix	352-355	4
β-strand	359-362	4	38
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	43
α-helix	388-400	13
α-helix	403-419	17
β-strand	425	1	43
α-helix	427-434	8
β-strand	438	1	44
α-helix	442-449	8
α-helix	451-453	3

Chain B: 28 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	45
α-helix	13-14	2
β-strand	15	1	15
β-strand	26	1	46
α-helix	31	1
β-strand	32	1	46
α-helix	33	1
β-strand	35-36	2	47
β-strand	39-40	2	47
α-helix	43-57	15
β-strand	61	1	48
β-strand	65-69	5	49
α-helix	76-86	11
β-strand	93-97	5	49
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-143	24	50
β-strand	153-163	11	50
β-strand	166-172	7	50
α-helix	174-182	9
β-strand	189-194	6	50
β-strand	199-205	7	50
β-strand	206	1	51
α-helix	207-209	3
β-strand	215	1	6
β-strand	221	1	51
α-helix	222-224	3
β-strand	229-239	11	50
α-helix	240-248	9
α-helix	258-261	4
α-helix	273-288	16
β-strand	292-296	5	50
β-strand	298-302	5	49
α-helix	304-306	3
α-helix	309-319	11
α-helix	324-325	2
β-strand	326-331	6	49
β-strand	333	1	52
α-helix	336	1
β-strand	337	1	53
α-helix	338	1
β-strand	345	1	53
α-helix	347-349	3
α-helix	352-355	4
β-strand	359-362	4	49
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	54
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	54
α-helix	427-436	10
β-strand	437-438	2	16
α-helix	440-449	10
α-helix	451-453	3

Chain C: 31 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	26	1	2
α-helix	31	1
β-strand	32	1	2
α-helix	33	1
β-strand	35-36	2	3
β-strand	39-40	2	3
α-helix	43-57	15
β-strand	61	1	4
β-strand	65-69	5	5
α-helix	76-87	12
β-strand	93-97	5	5
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-142	23	6
α-helix	143	1
α-helix	146-147	2
β-strand	152-163	12	6
β-strand	166-172	7	6
α-helix	174-176	3
α-helix	177-180	4
β-strand	189-194	6	6
β-strand	200-205	6	6
β-strand	206	1	7
α-helix	207-209	3
β-strand	215	1	8
α-helix	220	1
β-strand	221	1	7
α-helix	222-224	3
β-strand	229-239	11	6
α-helix	240-248	9
α-helix	256-263	8
α-helix	265-266	2
α-helix	273-288	16
β-strand	292-296	5	6
β-strand	298-302	5	5
α-helix	304-306	3
α-helix	309-320	12
β-strand	326-331	6	5
β-strand	333	1	9
α-helix	336	1
β-strand	337	1	10
α-helix	338	1
β-strand	345	1	10
α-helix	347-349	3
α-helix	352-355	4
β-strand	359-362	4	5
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	11
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	11
α-helix	427-436	10
β-strand	438	1	12
α-helix	440-449	10
α-helix	451-453	3

Chain D: 24 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	48
α-helix	38-40	3
β-strand	42-43	2	55
β-strand	46-47	2	55
α-helix	50-65	16
β-strand	68	1	34
β-strand	72-77	6	44
α-helix	83-94	12
β-strand	100-104	5	44
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-148	22	40
β-strand	158-164	7	40
β-strand	169-174	6	40
α-helix	175	1
α-helix	176-182	7
β-strand	191-196	6	40
β-strand	201-208	8	40
α-helix	209-211	3
β-strand	224-225	2	40
α-helix	226-229	4
β-strand	233-243	11	40
α-helix	244-250	7
α-helix	258-261	4
α-helix	270-285	16
β-strand	290-293	4	40
β-strand	295-299	5	44
α-helix	301-303	3
α-helix	306-315	10
β-strand	323-328	6	44
β-strand	333-334	2	56
α-helix	335	1
β-strand	341-342	2	56
α-helix	343-345	3
α-helix	348-351	4
β-strand	355-359	5	44
α-helix	360-363	4
α-helix	364-378	15
β-strand	382	1	57
α-helix	384-396	13
α-helix	400-416	17
β-strand	421	1	57
α-helix	423-432	10
β-strand	434	1	49
α-helix	436-441	6
α-helix	444-446	3
β-strand	451	1	52

Chain E: 21 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	4
β-strand	33	1	13
α-helix	38	1
β-strand	39	1	13
α-helix	40	1
β-strand	42-43	2	14
β-strand	46-47	2	14
α-helix	50-65	16
β-strand	68	1	15
β-strand	72-76	5	16
α-helix	83-93	11
β-strand	100-104	5	16
α-helix	105-108	4
α-helix	115-124	10
β-strand	127-150	24	6
β-strand	158-164	7	6
β-strand	169-174	6	6
α-helix	176-184	9
β-strand	191-196	6	6
β-strand	201	1	6
β-strand	204-207	4	6
β-strand	208	1	17
α-helix	209-212	4
β-strand	225	1	17
α-helix	226-229	4
β-strand	233-243	11	6
α-helix	244-252	9
α-helix	259-262	4
α-helix	270-285	16
β-strand	290-293	4	6
β-strand	295-299	5	16
α-helix	301-303	3
α-helix	306-315	10
β-strand	323-328	6	16
β-strand	332-334	3	18
α-helix	335	1
β-strand	341-343	3	18
α-helix	348-351	4
β-strand	355-358	4	16
α-helix	364-377	14
β-strand	382	1	19
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	19
α-helix	423-432	10
β-strand	434	1	5
α-helix	436-445	10
β-strand	451	1	9

Chain F: 25 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
β-strand	22	1	37
β-strand	33	1	58
α-helix	38	1
β-strand	39	1	58
α-helix	40	1
β-strand	42-43	2	59
β-strand	46-47	2	59
α-helix	50-65	16
β-strand	68	1	1
β-strand	72-76	5	12
α-helix	83-94	12
β-strand	100-104	5	12
α-helix	105-108	4
α-helix	115-124	10
β-strand	127-146	20	8
β-strand	159-165	7	8
β-strand	168-174	7	8
α-helix	176-184	9
β-strand	191-196	6	8
β-strand	202-208	7	8
α-helix	209-211	3
β-strand	217	1	39
β-strand	224-225	2	8
α-helix	226-228	3
β-strand	233-243	11	8
α-helix	244-252	9
α-helix	258-262	5
α-helix	270-286	17
β-strand	289-293	5	8
β-strand	295-299	5	12
α-helix	301-303	3
α-helix	306-315	10
β-strand	323-328	6	12
β-strand	333-334	2	60
α-helix	335	1
β-strand	341-342	2	60
α-helix	343-345	3
α-helix	348-351	4
β-strand	354-358	5	12
α-helix	361-363	3
α-helix	364-378	15
β-strand	382	1	61
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	61
α-helix	423-432	10
β-strand	434	1	38
α-helix	436-445	10
α-helix	447-449	3
β-strand	451	1	41

Chain G: 47 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	520-535	16
β-strand	539-540	2	62
α-helix	543-544	2
α-helix	551-554	4
α-helix	556-559	4
α-helix	564-567	4
β-strand	570-574	5	62
α-helix	576-578	3
α-helix	579-589	11
β-strand	595	1	62
β-strand	598	1	62
α-helix	602-609	8
α-helix	610-612	3
β-strand	626-630	5	62
α-helix	631-634	4
α-helix	638-642	5
β-strand	648-652	5	62
α-helix	654-657	4
α-helix	663-668	6
β-strand	675-679	5	62
α-helix	688-698	11
α-helix	708-711	4
α-helix	730-739	10
β-strand	743	1	62
α-helix	748-750	3
α-helix	756-757	2
β-strand	758-765	8	45
α-helix	769-779	11
α-helix	809-817	9
α-helix	819-821	3
α-helix	824-826	3
β-strand	828	1	63
β-strand	831	1	64
α-helix	835-837	3
β-strand	838-840	3	65
α-helix	842-847	6
α-helix	850-853	4
α-helix	855-863	9
α-helix	869-876	8
α-helix	889-892	4
α-helix	898-906	9
α-helix	908-932	25
α-helix	944-945	2
α-helix	959-964	6
α-helix	968-971	4
β-strand	980-990	11	6
α-helix	992-994	3
β-strand	996-1005	10	6
α-helix	1006-1007	2
β-strand	1017	1	64
α-helix	1019-1021	3
β-strand	1024-1026	3	65
α-helix	1029-1040	12
α-helix	1044-1051	8
α-helix	1055-1064	10
α-helix	1070-1073	4
α-helix	1076-1078	3
β-strand	1089	1	63
α-helix	1094-1099	6
α-helix	1101-1116	16
β-strand	1120-1123	4	45
α-helix	1127-1139	13
β-strand	1144-1147	4	45
α-helix	1153-1163	11
β-strand	1171-1174	4	45
β-strand	1190-1193	4	45
α-helix	1202-1208	7
β-strand	1219-1226	8	45
α-helix	1231-1247	17

Chain H: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	142-158	17
α-helix	173-175	3
α-helix	178-188	11
α-helix	213-233	21
β-strand	272-277	6	6
β-strand	282-286	5	6
β-strand	297-298	2	6
α-helix	300-303	4
α-helix	306-307	2
β-strand	308	1	66
β-strand	317	1	66
α-helix	318	1
β-strand	320-322	3	8
β-strand	328-329	2	8
α-helix	332-340	9

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like 1	A, B, C	protein	456	Homo sapiens	Q9Y265 (AlphaFold model)
RuvB-like 2	D, E, F	protein	463	Homo sapiens	Q9Y230 (AlphaFold model)
INO80 complex subunit C	I	protein	192	Homo sapiens	Q6PI98 (AlphaFold model)
Nucleosomal DNA Strand 1	K	DNA	152	synthetic construct
Nucleosomal DNA Strand 2	L	DNA	152	synthetic construct
Histone H3.1	M, Q	protein	136	Homo sapiens	P68431 (AlphaFold model)
Histone H4	N, R	protein	102	Homo sapiens	P62805
Histone H2A type 1-B/E	O, S	protein	129	Homo sapiens	P04908
Histone H2B type 2-E	P, T	protein	125	Homo sapiens	Q16778
Chromatin-remodeling ATPase INO80	G	protein	1556	Homo sapiens	Q9ULG1
INO80 complex subunit B	H	protein	356	Homo sapiens	Q9C086
Actin-related protein 5	J	protein	607	Homo sapiens	Q9H9F9

Sequence of entity 1 (A, B, C), FASTA

>9GEV_1 RuvB-like 1 (chains A, B, C)
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK

Sequence of entity 2 (D, E, F), FASTA

>9GEV_2 RuvB-like 2 (chains D, E, F)
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTT
PYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Sequence of entity 3 (I), FASTA

>9GEV_3 INO80 complex subunit C (chains I)
MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMS
ENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKYLKQILASERALPW
QLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTG
YLALRKATSIVP

Sequence of entity 4 (K), FASTA

>9GEV_4 Nucleosomal DNA Strand 1 (chains K)
CAATATCCCGAGTACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAG
TAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAG
AGCTGTCTACGACCAATTGAGCGGCCTCGGCA

Sequence of entity 5 (L), FASTA

>9GEV_5 Nucleosomal DNA Strand 2 (chains L)
TGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGC
TGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGAT
ATATACATCCTGTGCATGTACTCGGGATATTG

Sequence of entity 6 (M, Q), FASTA

>9GEV_6 Histone H3.1 (chains M, Q)
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA

Sequence of entity 7 (N, R), FASTA

>9GEV_7 Histone H4 (chains N, R)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Sequence of entity 8 (O, S), FASTA

>9GEV_8 Histone H2A type 1-B/E (chains O, S)
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKT
ESHHKAKGK

Sequence of entity 9 (P, T), FASTA

>9GEV_9 Histone H2B type 2-E (chains P, T)
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMG
IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK

Sequence of entity 10 (G), FASTA

>9GEV_10 Chromatin-remodeling ATPase INO80 (chains G)
MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
LLPQSGDPLIQVKEEPPNSLLGETSGAGSSGMLNTYSLNGVLQSESKCDKGNLYNFSKLK
KSRKWLKSILLSDESSEADSQSEDDDEEELNLSREELHNMLRLHKYKKLHQNKYSKDKEL
QQYQYYSAGLLSTYDPFYEQQRHLLGPKKKKFKEEKKLKAKLKKVKKKRRRDEELSSEES
PRRHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKVWLSIVKKELPKANKQKASAR
NLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKYEKVEKEHRKR
AEKEALEQRKLDEEMREAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLED
SSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESRAAA
LRAANKSGTGFGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKGMNWLANLYEQGINGI
LADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWG
NPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALKSS
SSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIESH
AENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILMYCQLTSRQKLLYQALKN
KISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPYHI
SKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAE
MANLMLQGLLARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFP
NLCSCPLLKSLVFSSHCKAVSGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAV
PLDSYCNDRSAEYERRVLKEGGSLAAKQCLLNGAPELAADWLNRRSQFFPEPAGGLWSIR
PQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYMVYR
KHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNP
TVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPDTLK
PKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRK
EGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDM
LVIVDDPASSAPQSRATNSPASITGSVSDTVNGISIQEMPAAGRGHSARSRGRPKGSGST
AKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA
GLADFGPSSASSPLSSPLSKGNNVPGNPKNLHMTSSLAPDSLVRKQGKGTNPSGGR

Sequence of entity 11 (H), FASTA

>9GEV_11 INO80 complex subunit B (chains H)
MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPT
QPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYR
AWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQ
RALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIE
RLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQGSTLSFPPGVPAPTAVSQRP
SPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGSPLLAT

Sequence of entity 12 (J), FASTA

>9GEV_12 Actin-related protein 5 (chains J)
MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQ
FRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHL
GVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSM
CSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLS
RMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQ
QLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSY
IQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEET
PGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYP
KDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDW
ALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGG
GGAGEQA

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	6

Primary citation

Recognition and remodelling of nucleosomes and hexasomes by the human INO80 complex. Aggarwal, P., Sharma, M., Woike, S. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag138 · PubMed

Other PDB entries of the same protein (UniProt Q9Y265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C9O 2.2 Å, 3D Structure of the human RuvB-like helicase RuvBL1
8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9EMA 2.4 Å, RUVBL1/2 in complex with ATP and CB-6644 inhibitor
6K0R 2.5 Å, Ruvbl1-Ruvbl2 with truncated domain II in complex with phosphorylated Cordycepin
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
2XSZ 3.0 Å, The dodecameric human RuvBL1:RuvBL2 complex with truncated domains II
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
7ZI4 3.2 Å, Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex

Browse structure collections

About this viewer

MolViewer shows 9GEV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.