NMDA bound to compound 345. Determined by X-ray diffraction at 1.82 Å resolution. Released 27 Nov 2024.
Explore 9GIC in 3D Show helices and sheets RCSB PDB PDBe
9GIC contains 18 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 398-402 | 5 | 1 |
| β-strand | 405 | 1 | 2 |
| β-strand | 409 | 1 | 2 |
| β-strand | 410-413 | 4 | 1 |
| α-helix | 419-422 | 4 | |
| β-strand | 424 | 1 | 3 |
| α-helix | 429 | 1 | |
| β-strand | 430 | 1 | 3 |
| α-helix | 431-432 | 2 | |
| β-strand | 434-439 | 6 | 1 |
| α-helix | 447-448 | 2 | |
| β-strand | 450-456 | 7 | 1 |
| α-helix | 458-469 | 12 | |
| β-strand | 474-478 | 5 | 1 |
| β-strand | 487-489 | 3 | 4 |
| β-strand | 496-498 | 3 | 4 |
| α-helix | 500-507 | 8 | |
| β-strand | 512-513 | 2 | 1 |
| α-helix | 517 | 1 | |
| β-strand | 518 | 1 | 5 |
| α-helix | 519 | 1 | |
| α-helix | 521-524 | 4 | |
| β-strand | 527-529 | 3 | 1 |
| α-helix | 530 | 1 | |
| α-helix | 532 | 1 | |
| β-strand | 534-543 | 10 | 5 |
| α-helix | 670-673 | 4 | |
| β-strand | 681-682 | 2 | 5 |
| β-strand | 684 | 1 | 6 |
| α-helix | 689-694 | 6 | |
| α-helix | 700-706 | 7 | |
| β-strand | 711 | 1 | 6 |
| α-helix | 714-722 | 9 | |
| β-strand | 728-732 | 5 | 5 |
| α-helix | 733-742 | 10 | |
| β-strand | 746-758 | 13 | 5 |
| β-strand | 761-763 | 3 | 1 |
| α-helix | 769-781 | 13 | |
| α-helix | 784-792 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamate receptor ionotropic, NMDA 1 | A | protein | 292 | Homo sapiens | Q05586 (AlphaFold model) |
>9GIC_1 Glutamate receptor ionotropic, NMDA 1 (chains A) MSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQ CCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMI VAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSV DIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTT GELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSR
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1ILQ | (2~{R})-2-azanyl-3-[[3-(phenylmethyl)-2~{H}-thiophen-5-yl]carbonylamino]propano… | C15 H18 N2 O3 S | 1 |
Water and common crystallization additives (SO4) are not listed.
Advancements in NMDA Receptor-Targeted Antidepressants: From d-Cycloserine Discovery to Preclinical Efficacy of Lu AF90103. Ascic, E., Marigo, M., David, L. et al. J Med Chem (2024) 67:20135-20155. DOI 10.1021/acs.jmedchem.4c01477 · PubMed
Other PDB entries of the same protein (UniProt Q05586 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.