Crystal Structure of UFC1 E149I. Determined by X-ray diffraction at 2.03 Å resolution. Released 7 May 2025.
Explore 9GLK in 3D Show helices and sheets RCSB PDB PDBe
9GLK contains 10 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-10 | 10 | |
| α-helix | 14-16 | 3 | |
| α-helix | 25-48 | 24 | |
| β-strand | 54-58 | 5 | 1 |
| β-strand | 64-73 | 10 | 1 |
| β-strand | 76-85 | 10 | 1 |
| α-helix | 86-87 | 2 | |
| α-helix | 94-95 | 2 | |
| β-strand | 98 | 1 | 1 |
| α-helix | 100-102 | 3 | |
| β-strand | 109 | 1 | 2 |
| β-strand | 114 | 1 | 1 |
| β-strand | 115 | 1 | 2 |
| α-helix | 121-128 | 8 | |
| α-helix | 134-137 | 4 | |
| α-helix | 138-142 | 5 | |
| α-helix | 143-155 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-fold modifier-conjugating enzyme 1 | AAA | protein | 169 | Homo sapiens | Q9Y3C8 (AlphaFold model) |
>9GLK_1 Ubiquitin-fold modifier-conjugating enzyme 1 (chains AAA) GSMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLES NKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLT DHFKPLWARNVPKFGLAHLMALGLGPWLAVIIPDLIQKGVIHHKEKCNQ
UFC1 reveals the multifactorial and plastic nature of oxyanion holes in E2 conjugating enzymes. Kumar, M., Banerjee, S., Cohen-Kfir, E. et al. Nat Commun (2025) 16:3912-3912. DOI 10.1038/s41467-025-58826-y · PubMed
Other PDB entries of the same protein (UniProt Q9Y3C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GLK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.