mouse VDAC1 in complex with MPD. Determined by X-ray diffraction at 2.4 Å resolution. Released 8 Jan 2025.
Explore 9GNG in 3D Show helices and sheets RCSB PDB PDBe
9GNG contains 2 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 12-19 | 8 | |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 38-48 | 11 | 1 |
| β-strand | 54-63 | 10 | 1 |
| β-strand | 69-76 | 8 | 1 |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 95-104 | 10 | 1 |
| β-strand | 109-120 | 12 | 1 |
| β-strand | 123-131 | 9 | 1 |
| β-strand | 137-146 | 10 | 1 |
| β-strand | 149-158 | 10 | 1 |
| β-strand | 163-174 | 12 | 1 |
| β-strand | 178-185 | 8 | 1 |
| β-strand | 189-199 | 11 | 1 |
| β-strand | 202-211 | 10 | 1 |
| β-strand | 214-228 | 15 | 1 |
| β-strand | 231-238 | 8 | 1 |
| β-strand | 242-252 | 11 | 1 |
| β-strand | 255-264 | 10 | 1 |
| β-strand | 275-282 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Isoform Mt-VDAC1 of Non-selective voltage-gated ion channel VDAC1 | X | protein | 295 | Mus musculus | Q60932 (AlphaFold model) |
>9GNG_1 Isoform Mt-VDAC1 of Non-selective voltage-gated ion channel VDAC1 (chains X) MRGSHHHHHHGSMAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSAN TETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTG KKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSN FAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVD PDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
| ID | Name | Formula | Copies |
|---|---|---|---|
| PX4 | 1,2-dimyristoyl-sn-glycero-3-phosphocholine | C36 H73 N O8 P | 1 |
Water and common crystallization additives (MPD) are not listed.
Protocol for high-yield bacterial expression and purification of the voltage-dependent anion channel 1 for high-throughput biophysical assays. Conti Nibali, S., Magri, A., Messina, A. et al. STAR Protoc (2025) 6:103557-103557. DOI 10.1016/j.xpro.2024.103557 · PubMed
Other PDB entries of the same protein (UniProt Q60932 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GNG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.