Crystal structure of human TRF1 TRFH domain in complex with compound 6. Determined by X-ray diffraction at 2.05 Å resolution. Released 26 Nov 2025.
Explore 9HFA in 3D Show helices and sheets RCSB PDB PDBe
9HFA contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 64-92 | 29 | |
| α-helix | 95-109 | 15 | |
| α-helix | 117-133 | 17 | |
| α-helix | 150-158 | 9 | |
| α-helix | 167-186 | 20 | |
| α-helix | 190-200 | 11 | |
| α-helix | 210-219 | 10 | |
| α-helix | 226-230 | 5 | |
| α-helix | 233-251 | 19 | |
| α-helix | 255-266 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Telomeric repeat-binding factor 1 | A | protein | 224 | Homo sapiens | P54274 (AlphaFold model) |
>9HFA_1 Telomeric repeat-binding factor 1 (chains A) SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNS AEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKE HDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTF HSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR
| ID | Name | Formula | Copies |
|---|---|---|---|
| TT3 | 2-(3-fluorophenoxy)-N,N-dimethylacetamide | C10 H12 F N O2 | 2 |
Water and common crystallization additives (GOL, DMS) are not listed.
Discovery of first-in-class inhibitors of the TRF1:TIN2 protein:protein interaction by fragment screening. Casale, G., Liu, M., Le Bihan, Y.V. et al. Sci Rep (2025) 15:40922-40922. DOI 10.1038/s41598-025-23858-3 · PubMed
Other PDB entries of the same protein (UniProt P54274 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9HFA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.