9HJO: FANCM-FAAP24-dsDNA complex

FANCM-FAAP24-dsDNA complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 11 Jun 2025.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, synthetic construct
Chains: 8
Atoms: 7,431
Mol. weight: 132.57 kDa
Ligands: MG
Released: 11 Jun 2025

Explore 9HJO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HJO contains 56 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1819-1823	5	1
α-helix	1824-1828	5
α-helix	1831-1839	9
β-strand	1844-1848	5	1
β-strand	1855-1856	2	1
β-strand	1861-1867	7	1
α-helix	1868-1872	5
α-helix	1874-1876	3
α-helix	1877-1888	12
β-strand	1893-1899	7	1
α-helix	1900-1902	3
α-helix	1916-1927	12
β-strand	1931-1935	5	1
α-helix	1938-1954	17
α-helix	1970-1977	8
α-helix	1984-1993	10
α-helix	1997-2001	5
α-helix	2005-2011	7
α-helix	2016-2026	11
α-helix	2032-2034	3

Chain B: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	2
α-helix	23-25	3
α-helix	29-34	6
β-strand	39-43	5	2
β-strand	50-51	2	2
β-strand	56-61	6	2
α-helix	63-68	6
α-helix	71-81	11
β-strand	86-92	7	2
α-helix	97-99	3
α-helix	101-105	5
α-helix	106-111	6
β-strand	115-119	5	2
α-helix	122-137	16
α-helix	140-142	3
α-helix	156-163	8
α-helix	173-180	8
α-helix	184-189	6
α-helix	192-199	8
α-helix	201-212	12

Chain D: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	4
α-helix	23-25	3
α-helix	29-34	6
β-strand	39-43	5	4
β-strand	50-51	2	4
β-strand	56-61	6	4
α-helix	63-68	6
α-helix	71-81	11
β-strand	86-92	7	4
α-helix	97-99	3
α-helix	101-105	5
α-helix	106-111	6
β-strand	115-119	5	4
α-helix	122-137	16
α-helix	140-142	3
α-helix	156-163	8
α-helix	173-180	8
α-helix	184-189	6
α-helix	192-198	7
α-helix	201-212	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fanconi anemia group M protein	A, C	protein	234	Homo sapiens	Q8IYD8 (AlphaFold model)
Fanconi anemia core complex-associated protein 24	B, D	protein	215	Homo sapiens	Q9BTP7 (AlphaFold model)
DNA (25-mer)	F, H	DNA	25	synthetic construct
DNA (25-mer)	G, I	DNA	25	synthetic construct

Sequence of entity 1 (A, C), FASTA

>9HJO_1 Fanconi anemia group M protein (chains A, C)
GKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNS
VNKNKFIEQIQHLQSMFERICVIVEKDREKTGDTSRMFRRTKSYDSLLTTLIGAGIRILF
SSCQEETADLLKELSLVEQRKNVGIHVPTVVNSNKSEALQFYLSIPNISYITALNMCHQF
SSVKRMANSSLQEISMYAQVTHQKAEEIYRYIHYVFDIQMLPNDLNQDRLKSDI

Sequence of entity 2 (B, D), FASTA

>9HJO_2 Fanconi anemia core complex-associated protein 24 (chains B, D)
MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILY
VTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVA
SQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQK
FPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR

Sequence of entity 3 (F, H), FASTA

>9HJO_3 DNA (25-MER) (chains F, H)
TACGCATCATCCAGCGCTCGGTTTT

Sequence of entity 4 (G, I), FASTA

>9HJO_4 DNA (25-MER) (chains G, I)
TTTTCCGAGCGCTGGATGATGCGTA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Primary citation

Structural basis of Fanconi anemia pathway activation by FANCM. Bythell-Douglas, R., van Twest, S., Abbouche, L. et al. EMBO J (2025) 44:4013-4036. DOI 10.1038/s44318-025-00468-3 · PubMed

Other PDB entries of the same protein (UniProt Q8IYD8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4E45 2.0 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi…
4BXO 2.15 Å, Architecture and DNA recognition elements of the Fanconi anemia FANCM- FAAP24 complex
9EL5 2.2 Å, FANCM translocase domain bound to DNA
4DRB 2.63 Å, The crystal structure of FANCM bound MHF complex
4M6W 2.9 Å, Crystal structure of the C-terminal segment of FANCM in complex with FAAP24
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 9HJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.