9HMH: Calf domains of Integrin Alpha5

Crystal structure of the Calf domains of Integrin Alpha5. Determined by X-ray diffraction at 1.92 Å resolution. Released 20 May 2026.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,716
Mol. weight: 40.25 kDa
Released: 20 May 2026

Explore 9HMH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HMH contains 7 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	39-41	3
β-strand	44-49	6	1
β-strand	54-56	3	2
β-strand	63-71	9	1
β-strand	77	1	3
β-strand	80-86	7	2
β-strand	91-95	5	1
β-strand	107-112	6	2
β-strand	115-123	9	2
β-strand	126	1	3
β-strand	131-139	9	1
β-strand	149-157	9	2
β-strand	165	1	2
α-helix	166-168	3
β-strand	169-176	8	2
β-strand	181-188	8	4
β-strand	191-194	4	5
β-strand	207	1	6
α-helix	208-210	3
β-strand	214-223	10	4
β-strand	229	1	7
β-strand	231-242	12	5
β-strand	245-246	2	5
β-strand	248-254	7	4
β-strand	257-260	4	5
α-helix	269	1
β-strand	270	1	6
α-helix	271-273	3
β-strand	297-299	3	5
β-strand	304-312	9	5
β-strand	315	1	7
β-strand	319-329	11	4
α-helix	331-335	5
β-strand	342-354	13	5
α-helix	360-361	2
β-strand	366-377	12	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-5	A	protein	359	Homo sapiens	P08648 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HMH_1 Integrin alpha-5 (chains A)
HHHHHHILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELR
VTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHL
RDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRD
QPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHP
INPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSL
QLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEG

Primary citation

Angiopoietin-2 interactions with active vs inactive alpha5beta1-integrin at cell-cell junctions determine TIE2-FOXO1 pathway activation. Sipila, T., Murthy, A.V., Ponna, S.K. et al. To be published.

Other PDB entries of the same protein (UniProt P08648 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WK0 1.78 Å, Metal Ion and Ligand Binding of Integrin
4WJK 1.85 Å, Metal Ion and Ligand Binding of Integrin
4WK2 2.5 Å, Metal Ion and Ligand Binding of Integrin
4WK4 2.5 Å, Metal Ion and Ligand Binding of Integrin
9B9J 2.6 Å, Integrin alpha-5 beta-1 in complex with BIIG2 Fab
9P6S 2.61 Å, Cryo-EM structure of human integrin alpha5beta1 in complex with fibronectin (FN 7-10)
9B9K 2.7 Å, Integrin alpha-5 beta-1 in complex with MINT1526A Fab
9HMI 2.87 Å, Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2…
3VI3 2.9 Å, Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
3VI4 2.9 Å, Crystal structure of alpha5beta1 integrin headpiece in complex with RGD peptide
9DIA 2.97 Å, Cryo-EM structure of alpha5beta1 integrin in complex with NeoNectin candidate 2
7NWL 3.1 Å, Cryo-EM structure of human integrin alpha5beta1 (open form) in complex with fibronectin…

Browse structure collections

About this viewer

MolViewer shows 9HMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.