9HMI: Calf domains of Integrin Alpha5

Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2 peptide. Determined by X-ray diffraction at 2.87 Å resolution. Released 20 May 2026.

Method: X-ray diffraction
Resolution: 2.87 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,903
Mol. weight: 39.76 kDa
Released: 20 May 2026

Explore 9HMI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HMI contains 5 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	15-21	7	1
β-strand	25-27	3	2
β-strand	34-42	9	1
β-strand	48	1	3
β-strand	49-57	9	2
β-strand	62-66	5	1
β-strand	78-82	5	2
β-strand	87-94	8	2
β-strand	97	1	3
β-strand	104-110	7	1
β-strand	120-130	11	2
α-helix	137-139	3
β-strand	140-147	8	2
β-strand	152-159	8	4
β-strand	162-165	4	5
β-strand	178	1	6
α-helix	179-181	3
β-strand	185-194	10	4
β-strand	200	1	7
β-strand	202-212	11	5
β-strand	217	1	5
β-strand	219-225	7	4
β-strand	231	1	5
β-strand	241	1	6
α-helix	243-244	2
β-strand	268-269	2	5
β-strand	275-283	9	5
β-strand	286	1	7
β-strand	291-300	10	4
β-strand	313-325	13	5
α-helix	331-332	2
β-strand	337-348	12	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-5	A	protein	346	Homo sapiens	P08648 (AlphaFold model)
Angiopoietin-2	P	protein	9	Homo sapiens	O15123 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HMI_1 Integrin alpha-5 (chains A)
DCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEY
SGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQF
DFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLG
PAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELD
PEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAK
TFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWT

Sequence of entity 2 (P), FASTA

>9HMI_2 Angiopoietin-2 (chains P)
EFVSQLTNQ

Primary citation

Angiopoietin-2 interactions with active vs inactive alpha5beta1-integrin at cell-cell junctions determine TIE2-FOXO1 pathway activation. Sipila, T., Ponna, S.K., Murthy, A.V. et al. To be published.

Other PDB entries of the same protein (UniProt P08648 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WK0 1.78 Å, Metal Ion and Ligand Binding of Integrin
4WJK 1.85 Å, Metal Ion and Ligand Binding of Integrin
9HMH 1.92 Å, Crystal structure of the Calf domains of Integrin Alpha5
4WK2 2.5 Å, Metal Ion and Ligand Binding of Integrin
4WK4 2.5 Å, Metal Ion and Ligand Binding of Integrin
9B9J 2.6 Å, Integrin alpha-5 beta-1 in complex with BIIG2 Fab
9P6S 2.61 Å, Cryo-EM structure of human integrin alpha5beta1 in complex with fibronectin (FN 7-10)
9B9K 2.7 Å, Integrin alpha-5 beta-1 in complex with MINT1526A Fab
3VI3 2.9 Å, Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
3VI4 2.9 Å, Crystal structure of alpha5beta1 integrin headpiece in complex with RGD peptide
9DIA 2.97 Å, Cryo-EM structure of alpha5beta1 integrin in complex with NeoNectin candidate 2
7NWL 3.1 Å, Cryo-EM structure of human integrin alpha5beta1 (open form) in complex with fibronectin…

Browse structure collections

About this viewer

MolViewer shows 9HMI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.