9HQ6: Ferritin heavy chain

Structural insights in the HuHf@gold-monocarbene adduct: aurophilicity revealed in a biological context. Determined by electron microscopy at 1.51 Å resolution. Released 7 May 2025.

Method: Electron microscopy
Resolution: 1.51 Å
Organism: Homo sapiens
Chains: 24
Atoms: 38,304
Mol. weight: 529.24 kDa
Ligands: AU, BM0
Released: 7 May 2025

Explore 9HQ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HQ6 contains 192 α-helices and 24 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X and Y: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	18-44	27
α-helix	53-79	27
β-strand	89	1	1
α-helix	90-92	3
α-helix	100-127	28
α-helix	131-137	7
α-helix	138-142	5
α-helix	143-162	20
α-helix	168-177	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferritin heavy chain	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y	protein	182	Homo sapiens	P02794 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y), FASTA

>9HQ6_1 Ferritin heavy chain (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y)
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSH
EEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKL
ATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDN
ES

Ligands and cofactors

ID	Name	Formula	Copies
AU	Gold ion	Au	96
BM0	1-butyl-3-methyl-1H-imidazol-3-ium	C8 H15 N2	24

Primary citation

Structural Insight Into a Human H Ferritin@Gold-Monocarbene Adduct: Aurophilicity Revealed in a Biological Context. Cosottini, L., Giachetti, A., Guerri, A. et al. Angew Chem Int Ed Engl (2025) 64:e202503778-e202503778. DOI 10.1002/anie.202503778 · PubMed

Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B8F 1.06 Å, Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
6B8G 1.13 Å, Twice-Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
7A6A 1.15 Å, 1.15 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
8B7O 1.17 Å, X-ray structure of Auranofin-human H-chain ferritin
6WYF 1.25 Å, Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a…
6Z6U 1.25 Å, 1.25 A structure of human apoferritin obtained from Titan Mono-BCOR microscope
7RRP 1.27 Å, Apoferritin structure at 1.27 angstrom resolution determined from a 300 kV Titan Krios…
7A6B 1.33 Å, 1.33 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
4Y08 1.34 Å, One minute iron loaded human H ferritin
7K3V 1.34 Å, Apoferritin structure at 1.34 angstrom resolution determined from a 300 kV Titan Krios…
7K3W 1.36 Å, Apoferritin structure at 1.36 angstrom resolution determined from a 300 kV Titan Krios…
9RGH 1.38 Å, X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein…

Browse structure collections

About this viewer

MolViewer shows 9HQ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.