sdAb1 in complex with PfCSP a-TSR domain. Determined by X-ray diffraction at 2.06 Å resolution. Released 23 Apr 2025.
Explore 9HZJ in 3D Show helices and sheets RCSB PDB PDBe
9HZJ contains 11 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 3 |
| β-strand | 10-13 | 4 | 4 |
| β-strand | 18-24 | 7 | 3 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 4 |
| α-helix | 44-45 | 2 | |
| β-strand | 46-51 | 6 | 4 |
| β-strand | 58-60 | 3 | 4 |
| β-strand | 68-73 | 6 | 3 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 3 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 4 |
| β-strand | 105 | 1 | 2 |
| α-helix | 109-111 | 3 | |
| β-strand | 114-115 | 2 | 4 |
| β-strand | 119-124 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 313-322 | 10 | |
| α-helix | 324-326 | 3 | |
| α-helix | 331-334 | 4 | |
| β-strand | 340-346 | 7 | 1 |
| α-helix | 348-350 | 3 | |
| α-helix | 355-357 | 3 | |
| β-strand | 359 | 1 | 2 |
| β-strand | 364-370 | 7 | 1 |
| α-helix | 372-374 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Circumsporozoite protein | B | protein | 91 | Plasmodium falciparum NF54 | P19597 (AlphaFold model) |
| sdAb1 | A | protein | 144 | Lama glama |
>9HZJ_1 Circumsporozoite protein (chains B) MEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKI CKMEKCSSVFNVVNSSENLYFQSGGHHHHHH
>9HZJ_2 sdAb1 (chains A) QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYSMGWFRLVPGKEREFVARISSSGGNTYY ADSVRGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLLQFGRSSRAADYDYWGQGTQ VTVSSAAAYPYDVPDYGSHHHHHH
Evidence for a model of conformational change by the Plasmodium falciparum circumsporozoite protein during sporozoite development in the mosquito host through the use of camelid single-domain antibodies. Geens, R., De Vocht, L., Aguirre-Botero, M.C. et al. Infect Immun (2025) 93:e0008125-e0008125. DOI 10.1128/iai.00081-25 · PubMed
Other PDB entries of the same protein (UniProt P19597 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9HZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.