9HZJ: SdAb1

sdAb1 in complex with PfCSP a-TSR domain. Determined by X-ray diffraction at 2.06 Å resolution. Released 23 Apr 2025.

Method: X-ray diffraction
Resolution: 2.06 Å
Organisms: Plasmodium falciparum NF54, Lama glama
Chains: 2
Atoms: 1,622
Mol. weight: 26.76 kDa
Released: 23 Apr 2025

Explore 9HZJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HZJ contains 11 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	3
β-strand	10-13	4	4
β-strand	18-24	7	3
α-helix	29-31	3
β-strand	33-39	7	4
α-helix	44-45	2
β-strand	46-51	6	4
β-strand	58-60	3	4
β-strand	68-73	6	3
α-helix	74-76	3
β-strand	78-83	6	3
α-helix	88-90	3
β-strand	92-99	8	4
β-strand	105	1	2
α-helix	109-111	3
β-strand	114-115	2	4
β-strand	119-124	6	4

Chain B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	313-322	10
α-helix	324-326	3
α-helix	331-334	4
β-strand	340-346	7	1
α-helix	348-350	3
α-helix	355-357	3
β-strand	359	1	2
β-strand	364-370	7	1
α-helix	372-374	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Circumsporozoite protein	B	protein	91	Plasmodium falciparum NF54	P19597 (AlphaFold model)
sdAb1	A	protein	144	Lama glama

Sequence of entity 1 (B), FASTA

>9HZJ_1 Circumsporozoite protein (chains B)
MEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKI
CKMEKCSSVFNVVNSSENLYFQSGGHHHHHH

Sequence of entity 2 (A), FASTA

>9HZJ_2 sdAb1 (chains A)
QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYSMGWFRLVPGKEREFVARISSSGGNTYY
ADSVRGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLLQFGRSSRAADYDYWGQGTQ
VTVSSAAAYPYDVPDYGSHHHHHH

Primary citation

Evidence for a model of conformational change by the Plasmodium falciparum circumsporozoite protein during sporozoite development in the mosquito host through the use of camelid single-domain antibodies. Geens, R., De Vocht, L., Aguirre-Botero, M.C. et al. Infect Immun (2025) 93:e0008125-e0008125. DOI 10.1128/iai.00081-25 · PubMed

Other PDB entries of the same protein (UniProt P19597 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6O24 1.4 Å, Crystal structure of 4498 Fab in complex with circumsporozoite protein NANP3 and…
8FDD 1.54 Å, Crystal structure of Ky15.3 Fab in complex with circumsporozoite protein NPDP peptide
8FAS 1.55 Å, Crystal structure of Ky230 Fab in complex with circumsporozoite protein NANP5 peptide
6VLN 1.63 Å, Crystal structure of 4498 Fab in complex with circumsporozoite protein DND3 and…
8FB8 1.69 Å, Crystal structure of Ky15.10-Y100EK Fab in complex with circumsporozoite protein KQPA…
6ULF 1.7 Å, Crystal structure of 4498 Fab in complex with circumsporozoite protein NDN3 and…
8F9U 1.7 Å, Crystal structure of Ky15.7 Fab in complex with circumsporozoite protein NPDP peptide
8FB7 1.75 Å, Crystal structure of Ky15.10 Fab in complex with circumsporozoite protein NPDP peptide
6O26 1.8 Å, Crystal structure of 3246 Fab in complex with circumsporozoite protein NANA
8FA7 1.8 Å, Crystal structure of Ky15.11 Fab in complex with circumsporozoite protein KQPA peptide
8FA8 1.8 Å, Crystal structure of Ky15.11 Fab in complex with circumsporozoite protein NDN peptide
8FDC 1.8 Å, Crystal structure of Ky311 Fab in complex with circumsporozoite protein KQPA peptide

Browse structure collections

About this viewer

MolViewer shows 9HZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.