Single particle cryo electron microscopy of a Fab fragment bound to recombinant human CD40 ligand. Determined by electron microscopy at 3.4 Å resolution. Released 25 Feb 2026.
Explore 9I5N in 3D Show helices and sheets RCSB PDB PDBe
9I5N contains 8 α-helices and 38 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 6 |
| β-strand | 10-13 | 4 | 7 |
| α-helix | 18 | 1 | |
| β-strand | 19-25 | 7 | 6 |
| β-strand | 34-38 | 5 | 7 |
| β-strand | 45-48 | 4 | 7 |
| α-helix | 53 | 1 | |
| β-strand | 54 | 1 | 7 |
| α-helix | 55 | 1 | |
| β-strand | 62-66 | 5 | 6 |
| β-strand | 70-75 | 6 | 6 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-89 | 5 | 7 |
| α-helix | 96 | 1 | |
| β-strand | 102-106 | 5 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 1 |
| β-strand | 6-7 | 2 | 2 |
| β-strand | 11 | 1 | 3 |
| β-strand | 16 | 1 | 4 |
| β-strand | 19-23 | 5 | 2 |
| β-strand | 25 | 1 | 1 |
| β-strand | 34-40 | 7 | 5 |
| β-strand | 44-47 | 4 | 5 |
| α-helix | 61-63 | 3 | |
| β-strand | 68-72 | 5 | 2 |
| β-strand | 77-81 | 5 | 2 |
| β-strand | 85 | 1 | 4 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-98 | 8 | 5 |
| β-strand | 107-110 | 4 | 5 |
| α-helix | 111-113 | 3 | |
| β-strand | 114-116 | 3 | 5 |
| β-strand | 117 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 123-128 | 6 | 8 |
| β-strand | 137 | 1 | 9 |
| β-strand | 140-141 | 2 | 8 |
| β-strand | 147-148 | 2 | 8 |
| β-strand | 153-156 | 4 | 9 |
| β-strand | 160-163 | 4 | 9 |
| β-strand | 167-179 | 13 | 8 |
| β-strand | 189-196 | 8 | 9 |
| β-strand | 207-210 | 4 | 9 |
| β-strand | 219-231 | 13 | 8 |
| β-strand | 236-241 | 6 | 9 |
| β-strand | 247 | 1 | 8 |
| β-strand | 255-260 | 6 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab20 heavy chain | B | protein | 118 | Mus musculus | |
| Fab20 light chain | A | protein | 107 | Mus musculus | |
| CD40 ligand, soluble form | C | protein | 143 | Homo sapiens | P29965 (AlphaFold model) |
>9I5N_1 Fab20 heavy chain (chains B) QVQLKQSGPGLVQPSQSLSITCTVSGFSLTGYGVHWVRQSPGKGLEWLGMIWSGGSTDYN AAFISRLSISKDSSKSQVFFKMNSLQANDTAIYYCARSSGNYGEDAMDYWGQGTSVTV
>9I5N_2 Fab20 light chain (chains A) ETTVTQSPASLSMAIGEKVTIRCITSTDIDDDMNWYQQKPGEPPELLISEDNTLRPGVPS RFSSSGYGTDFVFAIENMLPEDVADYFCLQSDNLPFTFGSGTKLEIK
>9I5N_3 CD40 ligand, soluble form (chains C) NPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFC SNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVF VNVTDPSQVSHGTGFTSFGLLKL
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
Curbing Autoimmunity: A New Fab Fragment Targeting CD40-CD40L Halts B-Cell Activation and Differentiation. Pedersen, K., Green, K., Kristoffersen, E.L. et al. Eur J Immunol (2026) 56:e70158-e70158. DOI 10.1002/eji.70158 · PubMed
Other PDB entries of the same protein (UniProt P29965 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9I5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.