9I90: CP of empty RHDV virion

CP of empty RHDV virion. Determined by electron microscopy at 3.2 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Rabbit hemorrhagic disease virus
Chains: 3
Atoms: 12,059
Mol. weight: 180.03 kDa
Released: 26 Nov 2025

Explore 9I90 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I90 contains 53 α-helices and 154 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 53 β-strands

Element	Residues	Length	Sheet
α-helix	40-43	4
α-helix	46-52	7
α-helix	53-56	4
β-strand	60	1	1
β-strand	73-81	9	2
β-strand	89-94	6	3
α-helix	97-99	3
α-helix	106-109	4
β-strand	110	1	4
β-strand	113-114	2	1
β-strand	117-123	7	2
β-strand	130	1	5
β-strand	132-138	7	3
α-helix	139	1
α-helix	150-152	3
β-strand	155-159	5	3
α-helix	165	1
β-strand	166-170	5	2
β-strand	179	1	1
β-strand	189-194	6	3
β-strand	199	1	5
β-strand	208-217	10	2
β-strand	222-223	2	1
β-strand	226	1	4
α-helix	245-247	3
β-strand	253	1	6
β-strand	260	1	6
β-strand	261-266	6	7
β-strand	278	1	8
β-strand	284	1	8
β-strand	295-296	2	9
β-strand	300	1	10
β-strand	301-303	3	11
β-strand	312	1	12
β-strand	315-319	5	11
β-strand	339	1	13
β-strand	340	1	11
α-helix	341-343	3
α-helix	348-350	3
β-strand	355-362	8	11
α-helix	366-367	2
β-strand	368-382	15	11
β-strand	389-390	2	11
β-strand	393	1	14
β-strand	398-403	6	11
β-strand	407	1	12
β-strand	415	1	10
β-strand	416-418	3	11
β-strand	419-420	2	9
β-strand	425	1	11
β-strand	426	1	15
β-strand	437	1	7
β-strand	443	1	13
β-strand	445	1	14
α-helix	450-452	3
β-strand	459-460	2	16
β-strand	461-466	6	7
β-strand	469	1	15
α-helix	482-484	3
β-strand	485-488	4	7
α-helix	492-499	8
β-strand	511-518	8	17
β-strand	523-526	4	17
β-strand	527-528	2	16
β-strand	534-536	3	16
β-strand	545-546	2	7
β-strand	553-560	8	17
α-helix	564-566	3
β-strand	567-568	2	17

Chain B: 19 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	18
α-helix	43-50	8
α-helix	52-56	5
β-strand	60	1	19
α-helix	67-70	4
β-strand	73-81	9	18
α-helix	84-85	2
β-strand	89-94	6	20
α-helix	97-99	3
α-helix	101-107	7
β-strand	113-114	2	19
β-strand	117-124	8	18
β-strand	130	1	21
β-strand	132-138	7	20
α-helix	150-152	3
β-strand	155-159	5	20
β-strand	166-170	5	18
β-strand	179	1	19
β-strand	189-194	6	20
β-strand	199	1	21
β-strand	208-217	10	18
β-strand	222-223	2	19
α-helix	236-238	3
α-helix	245-247	3
β-strand	261-266	6	22
α-helix	267	1
α-helix	277	1
β-strand	278	1	23
α-helix	279	1
β-strand	284	1	23
β-strand	294-296	3	24
β-strand	300	1	25
β-strand	301-303	3	24
β-strand	312	1	26
β-strand	315-319	5	24
β-strand	339	1	27
β-strand	340	1	24
α-helix	341-343	3
α-helix	349-350	2
β-strand	354-361	8	24
α-helix	367	1
β-strand	368-382	15	24
β-strand	389-390	2	24
β-strand	393	1	28
β-strand	398-403	6	24
β-strand	407	1	26
β-strand	415	1	25
β-strand	417-421	5	24
β-strand	425	1	24
β-strand	426	1	29
β-strand	437	1	22
β-strand	443	1	27
β-strand	445	1	28
α-helix	449-452	4
β-strand	455	1	30
β-strand	458	1	30
β-strand	459-460	2	31
β-strand	461-466	6	22
β-strand	469	1	29
β-strand	485-488	4	22
α-helix	492-500	9
β-strand	509	1	31
β-strand	511-518	8	31
β-strand	523-524	2	31
β-strand	526-528	3	31
β-strand	534-536	3	31
α-helix	543-544	2
β-strand	545-546	2	22
β-strand	552-560	9	31
α-helix	564-566	3
β-strand	567-568	2	31

Chain C: 18 helices, 49 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	32
α-helix	43-53	11
α-helix	54-56	3
β-strand	60	1	33
α-helix	67-70	4
β-strand	73-81	9	32
α-helix	84-85	2
β-strand	89-94	6	34
α-helix	106-108	3
β-strand	110	1	35
β-strand	112-114	3	33
β-strand	117-123	7	32
β-strand	130-138	9	34
α-helix	139	1
α-helix	150-152	3
β-strand	155-159	5	34
β-strand	166-170	5	32
α-helix	171	1
β-strand	179-180	2	33
β-strand	189-199	11	34
β-strand	208-217	10	32
β-strand	222-223	2	33
β-strand	226	1	35
α-helix	234-237	4
α-helix	245-246	2
α-helix	247-251	5
β-strand	253	1	36
β-strand	254	1	37
β-strand	260	1	36
β-strand	261-266	6	38
β-strand	271	1	39
β-strand	278	1	40
β-strand	284	1	40
β-strand	295-297	3	41
β-strand	301-303	3	41
β-strand	312	1	42
α-helix	313-314	2
β-strand	315-319	5	41
β-strand	340	1	41
α-helix	341-343	3
β-strand	354-361	8	41
α-helix	367	1
β-strand	368-381	14	41
β-strand	390	1	41
β-strand	393	1	43
β-strand	398-403	6	41
β-strand	407	1	42
β-strand	417-420	4	41
β-strand	425-426	2	41
β-strand	445	1	43
β-strand	452	1	39
β-strand	455	1	44
β-strand	458	1	44
β-strand	459-466	8	38
β-strand	469	1	41
β-strand	485-488	4	38
β-strand	491	1	37
α-helix	492-500	9
α-helix	504-506	3
β-strand	511-518	8	38
β-strand	523-528	6	38
β-strand	534-536	3	38
α-helix	543-544	2
β-strand	545	1	38
β-strand	552-560	9	38
α-helix	564-566	3
β-strand	567-568	2	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein VP60	A, B, C	protein	577	Rabbit hemorrhagic disease virus	Q86119

Sequence of entity 1 (A, B, C), FASTA

>9I90_1 Capsid protein VP60 (chains A, B, C)
GKARTAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVVTAENSSASIATAGIGGPPQQV
DQQETWRTNFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFI
VAGSGVFGGRLVAAVIPPGIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTG
DPGLVPTLVLSVYNNLINPFGGSTSAIQVTVETRPSEDFEFVMIRAPSSKTVDSISPAGL
LTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNLNGSTYGWSSPRFADIDHRRGSA
SYPGNNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIPAAGWVGFGAIWN
SNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGSQTVAKSIYAVVTGTAQNPAGLFVMA
SGVISTPSANAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRTGDVNATAGSANG
TQYGTGSQPLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSVDGYFYAGTGAST
TLIDLTELIDVRPVGPRPSKSTLVFNLGGTANGFSYV

Primary citation

Structure of empty RHDV virion at 3.2 angstroms resolution. Novoa, G., Martinez-Romero, J.M., Perez-Mata, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q86119), best resolution first:

8CYL 1.89 Å, Ast89 P domain
9I3H 2.5 Å, CP of RHDV mutant - N15
9I8J 2.9 Å, AB Spike of RHDV mutant N15
9I3E 3.0 Å, CP of RHDV mutant - 29N
9I8R 3.3 Å, CP of RHDV VLP (VP1)
9I9D 3.3 Å, CP of RHDV virion (full particle)
3ZUE 10.3 Å, Rabbit Hemorrhagic Disease Virus (RHDV)capsid protein

Browse structure collections

About this viewer

MolViewer shows 9I90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.