Structure of a Chimeric Protein Composed of the SNX5 PX Domain and the N-Terminal Region of NCOA7-AS, crystal form I. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Jan 2026.
Explore 9IAE in 3D Show helices and sheets RCSB PDB PDBe
9IAE contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31-34 | 4 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 62-68 | 7 | 1 |
| α-helix | 69-81 | 13 | |
| α-helix | 83-85 | 3 | |
| α-helix | 90-97 | 8 | |
| α-helix | 100-109 | 10 | |
| α-helix | 118-152 | 35 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-167 | 8 | |
| α-helix | 171-173 | 3 | |
| β-strand | 177-181 | 5 | 2 |
| β-strand | 189-193 | 5 | 2 |
| α-helix | 195-199 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorting nexin-5,Nuclear receptor coactivator 7 | A | protein | 178 | Homo sapiens | H0Y6T0 (AlphaFold model), Q9Y5X3 (AlphaFold model) |
>9IAE_1 Sorting nexin-5,Nuclear receptor coactivator 7 (chains A) GLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETT DYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSH EVFLQRLSSHPVLSKDRNFHVFLEYDQRLPLDIQIFYCARPDEEPFVKIITVEEAKRR
SNX-BAR proteins 5 and 6 are required for NCOA7-AS antiviral activity against influenza A virus. Arnaud-Arnould, M., Rebendenne, A., Tauziet, M. et al. J Biol Chem (2026) 302:113372-113372. DOI 10.1016/j.jbc.2026.113372 · PubMed
Other PDB entries of the same protein (UniProt H0Y6T0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9IAE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.