9IGY: Sorting nexin-5,Nuclear receptor coactivator 7

Structure of a Chimeric Protein Composed of the SNX5 PhoX Domain and the N-terminal domain of NCOA7-AS,crystal form II. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Jan 2026.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,665
Mol. weight: 82.49 kDa
Released: 28 Jan 2026

Explore 9IGY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IGY contains 32 α-helices and 25 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	1
β-strand	37-41	5	1
β-strand	44-53	10	1
β-strand	62-68	7	1
α-helix	69-81	13
α-helix	83-85	3
α-helix	90-97	8
α-helix	100-112	13
β-strand	113	1	2
β-strand	116	1	2
α-helix	118-152	35
α-helix	156-158	3
α-helix	160-167	8
β-strand	177-181	5	3
β-strand	189-193	5	3

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	31-41	11	4
β-strand	44-53	10	4
β-strand	62-68	7	4
α-helix	69-80	12
α-helix	91-97	7
α-helix	100-111	12
α-helix	113-115	3
α-helix	118-152	35
α-helix	156-158	3
α-helix	160-167	8
β-strand	177-181	5	5
β-strand	189-193	5	5

Chain C: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	3
β-strand	37-41	5	3
β-strand	44-53	10	3
β-strand	62-68	7	3
α-helix	69-81	13
α-helix	83-85	3
α-helix	90-97	8
α-helix	100-111	12
α-helix	112-115	4
α-helix	118-152	35
α-helix	156-158	3
α-helix	160-167	8
α-helix	171-173	3
β-strand	177-181	5	1
β-strand	189-193	5	1

Chain D: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	5
β-strand	37-41	5	5
β-strand	44-53	10	5
β-strand	62-68	7	5
α-helix	69-80	12
α-helix	83-85	3
α-helix	89-97	9
α-helix	100-111	12
α-helix	113-115	3
α-helix	118-152	35
α-helix	156-158	3
α-helix	160-167	8
α-helix	171-173	3
β-strand	177-181	5	4
β-strand	189-193	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-5,Nuclear receptor coactivator 7	A, B, C, D	protein	178	Homo sapiens	H0Y6T0 (AlphaFold model), Q9Y5X3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9IGY_1 Sorting nexin-5,Nuclear receptor coactivator 7 (chains A, B, C, D)
GLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETT
DYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSH
EVFLQRLSSHPVLSKDRNFHVFLEYDQRLPLDIQIFYCARPDEEPFVKIITVEEAKRR

Primary citation

SNX-BAR proteins 5 and 6 are required for NCOA7-AS antiviral activity against influenza A virus. Arnaud-Arnould, M., Rebendenne, A., Tauziet, M. et al. J Biol Chem (2026) 302:113372-113372. DOI 10.1016/j.jbc.2026.113372 · PubMed

Other PDB entries of the same protein (UniProt H0Y6T0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAE 2.3 Å, Structure of a Chimeric Protein Composed of the SNX5 PX Domain and the N-Terminal Region…

Browse structure collections

About this viewer

MolViewer shows 9IGY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.