9IQV: MT3-alpha1AAR

Cryo-EM structure of MT3-alpha1AAR. Determined by electron microscopy at 3.3 Å resolution. Released 23 Jul 2025.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Dendroaspis angusticeps, Homo sapiens, synthetic construct
Chains: 2
Atoms: 2,662
Mol. weight: 56.37 kDa
Released: 23 Jul 2025

Explore 9IQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IQV contains 13 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	11-16	6	1
β-strand	23-32	10	2
β-strand	35-43	9	2
α-helix	46-49	4
β-strand	54-58	5	2

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	23-52	30
α-helix	60-89	30
α-helix	96-129	34
α-helix	134-137	4
α-helix	140-163	24
α-helix	167-170	4
α-helix	182-189	8
α-helix	190-194	5
α-helix	195-213	19
α-helix	263-297	35
α-helix	305-329	25
α-helix	331-340	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic toxin 3	A	protein	65	Dendroaspis angusticeps	P81031 (AlphaFold model)
Alpha-1A adrenergic receptor,Soluble cytochrome b562	B	protein	440	Homo sapiens, synthetic construct	P35348 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9IQV_1 Muscarinic toxin 3 (chains A)
LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKT
DKCNE

Sequence of entity 2 (B), FASTA

>9IQV_2 Alpha-1A adrenergic receptor,Soluble cytochrome b562 (chains B)
SGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYY
IVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDR
YIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGY
VLFSALGSFYLPLAIILVMYCRVYVVAKRELADLEDNWETLNDNLKVIEKADNAAQVKDA
LTKMRAAALDAQKASGSGSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKT
TRNAYIQKYLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIV
FWLGYLNSCINPIIYPCSSQEFKKAFQNVLKIAALKEKIAALKEKIAALKEAEEKRASRL
EEELRRRLTEGSHHHHHHHH

Primary citation

Structure-guided engineering of snake toxins for selective modulation of adrenergic and muscarinic receptors. Zhong, Y., Tao, H., Zhang, Y. et al. Nat Commun (2025) 16:6478-6478. DOI 10.1038/s41467-025-61695-0 · PubMed

Other PDB entries of the same protein (UniProt P81031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IQR 3.4 Å, Cryo-EM structure of MT3-alpha2AAR
9IQS 3.6 Å, Cryo-EM structure of MT3-Muscarinic acetylcholine receptor 4

Browse structure collections

About this viewer

MolViewer shows 9IQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.