9J54: FIP200 Claw

Crystal structure of FIP200 Claw in complex with ATG16L1. Determined by X-ray diffraction at 1.61 Å resolution. Released 13 Aug 2025.

Method: X-ray diffraction
Resolution: 1.61 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,852
Mol. weight: 28.86 kDa
Released: 13 Aug 2025

Explore 9J54 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9J54 contains 9 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	-2-1492	5
β-strand	1496	1	1
β-strand	1506-1512	7	1
α-helix	1513-1515	3
β-strand	1517-1520	4	1
β-strand	1528-1530	3	1
α-helix	1531	1
α-helix	1532-1534	3
α-helix	1536-1538	3
β-strand	1555-1567	13	1
β-strand	1581-1589	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	240-242	3	1

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1496	1	1
β-strand	1506-1512	7	1
α-helix	1513-1515	3
β-strand	1517-1520	4	1
β-strand	1528-1530	3	1
α-helix	1531	1
α-helix	1532-1534	3
α-helix	1536-1538	3
β-strand	1554-1567	14	1
β-strand	1581-1589	9	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	240-244	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RB1-inducible coiled-coil protein 1	A, C	protein	111	Homo sapiens	Q8TDY2 (AlphaFold model)
Autophagy-related protein 16-1	B, D	protein	17	Homo sapiens	E7EVC7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>9J54_1 RB1-inducible coiled-coil protein 1 (chains A, C)
GPGSEFSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPG
EGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Sequence of entity 2 (B, D), FASTA

>9J54_2 Autophagy-related protein 16-1 (chains B, D)
GPGSEQDDDIEVIVDET

Primary citation

Molecular bases of the interactions of ATG16L1 with FIP200 and ATG8 family proteins. Gong, X., Zhou, Y., Wang, Y. et al. Nat Commun (2025) 16:9035-9035. DOI 10.1038/s41467-025-64097-4 · PubMed

Other PDB entries of the same protein (UniProt Q8TDY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D0E 1.4 Å, Crystal structure of FIP200 Claw/p-CCPG1 FIR2
9D34 1.42 Å, FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1…
8YFL 1.5 Å, crystal structure of FIP200 claw/TNIP1_FIR_pS122pS123
8YFM 1.5 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS122
6DCE 1.56 Å, X-ray structure of FIP200 claw domain
7CZG 1.8 Å, Crystal structure of FIP200 Claw domain apo form
9LUA 1.97 Å, Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
8YFK 2.0 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS123
7EA2 2.14 Å, crystal structure of NAP1 FIR in complex with RB1CC1 Claw domain
8YFN 2.3 Å, Crystal structure of FIP200 claw in complex with TNIP1_FIR_pS123 peptide with an…
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain

Browse structure collections

About this viewer

MolViewer shows 9J54 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.