9LUA: FIP200 Claw domain and SMCR8 FIR motif complex

Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex. Determined by X-ray diffraction at 1.97 Å resolution. Released 12 Aug 2026.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,650
Mol. weight: 27.18 kDa
Ligands: PO4
Released: 12 Aug 2026

Explore 9LUA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LUA contains 6 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1506-1512	7	1
β-strand	1517-1520	4	1
β-strand	1528-1530	3	1
α-helix	1531	1
α-helix	1534-1537	4
β-strand	1554-1567	14	1
α-helix	1576-1577	2
β-strand	1581-1588	8	1

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1506-1512	7	2
β-strand	1517-1520	4	2
β-strand	1528-1530	3	2
α-helix	1531	1
α-helix	1534-1537	4
β-strand	1554-1567	14	2
α-helix	1576-1577	2
β-strand	1581-1589	9	2

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-11	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RB1-inducible coiled-coil protein 1	A, B	protein	106	Homo sapiens	Q8TDY2 (AlphaFold model)
Guanine nucleotide exchange protein SMCR8	C, D	protein	13	Homo sapiens	Q8TEV9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9LUA_1 RB1-inducible coiled-coil protein 1 (chains A, B)
SSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASG
ASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Sequence of entity 2 (C, D), FASTA

>9LUA_2 Guanine nucleotide exchange protein SMCR8 (chains C, D)
SSGESIEVLGTEK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex. Tang, D., Bao, H. To be published.

Other PDB entries of the same protein (UniProt Q8TDY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D0E 1.4 Å, Crystal structure of FIP200 Claw/p-CCPG1 FIR2
9D34 1.42 Å, FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1…
8YFL 1.5 Å, crystal structure of FIP200 claw/TNIP1_FIR_pS122pS123
8YFM 1.5 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS122
6DCE 1.56 Å, X-ray structure of FIP200 claw domain
9J54 1.61 Å, Crystal structure of FIP200 Claw in complex with ATG16L1
7CZG 1.8 Å, Crystal structure of FIP200 Claw domain apo form
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
8YFK 2.0 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS123
7EA2 2.14 Å, crystal structure of NAP1 FIR in complex with RB1CC1 Claw domain
8YFN 2.3 Å, Crystal structure of FIP200 claw in complex with TNIP1_FIR_pS123 peptide with an…
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain

Browse structure collections

About this viewer

MolViewer shows 9LUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.