9JA5: Tdk1-Bdf1 complex

Cryo-EM structure of Tdk1-Bdf1 complex. Determined by electron microscopy at 2.7 Å resolution. Released 13 Nov 2024.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Schizosaccharomyces pombe 972h-, Streptococcus sp. group G
Chains: 6
Atoms: 8,469
Mol. weight: 296.04 kDa
Released: 13 Nov 2024

Explore 9JA5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JA5 contains 60 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	212-274	63
α-helix	289-291	3
α-helix	295-296	2
α-helix	300-304	5
α-helix	310-317	8
α-helix	327-329	3
α-helix	331-338	8
α-helix	343-346	4
α-helix	351-353	3
α-helix	529-545	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Meiotically up-regulated gene 135 protein,SWR1 complex bromodomain subunit bdf1,Immunoglobulin…	A, B, C, D, E, F	protein	444	Schizosaccharomyces pombe 972h-, Streptococcus sp. group G	O74876 (AlphaFold model), P06654 (AlphaFold model), Q9Y7N0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>9JA5_1 Meiotically up-regulated gene 135 protein,SWR1 complex bromodomain subunit bdf1,Immunoglobulin G-binding protein G (chains A, B, C, D, E, F)
MDEWRKSTDEWRKSTDERLENLLNIVREILDVQRDMRNDLSNLTRKVDRMDMRLSRNNNM
IMRSFAQPITEVPFFNGDIPDPNLPRITRIEDIDSLSEENCTRYLKGYGVSYDENDQSLW
KRQLAKAVGLTAAYDESYTFSPFSSSESGGGSGGGSGGGSGFKKASSSDNKEQGGGSGGG
SGSGGGSQEAETDALFDNGEEEEALMSEEEINGAKFAAVDKQISMLQDTLEAMKAKKMNR
MRKPRRRDLTKEYGPITYAMQNELAERCNYLSAEQLSNVAEILREEMPWLRDTDEIEIDV
GNMKPEVFHRIYRYVCKPDADSSEPASPVLMPTKPEKKKGRVLSETEQAEKIRRLQQQLD
RFAGKTSPTSSGGGSSGGGSTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG
EWTYDDATKTFTVTEGSGLEVLFQ

Primary citation

A meiotic driver hijacks an epigenetic reader to disrupt mitosis in noncarrier offspring. Hua, Y., Zhang, J., Yang, M.Y. et al. Proc Natl Acad Sci U S A (2024) 121:e2408347121-e2408347121. DOI 10.1073/pnas.2408347121 · PubMed

Other PDB entries of the same protein (UniProt O74876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9JA6 4.4 Å, Cryo-EM structure of Tdk1 tetramer complex

Browse structure collections

About this viewer

MolViewer shows 9JA5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.