Crystal structure of PCoV-GX receptor-binding domain complexed with squirrel ACE2. Determined by X-ray diffraction at 3.43 Å resolution. Released 6 Aug 2025.
Explore 9JR7 in 3D Show helices and sheets RCSB PDB PDBe
9JR7 contains 45 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-52 | 32 | |
| α-helix | 56-80 | 25 | |
| α-helix | 85-87 | 3 | |
| α-helix | 91-101 | 11 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-129 | 20 | |
| β-strand | 131-132 | 2 | 1 |
| α-helix | 138-140 | 3 | |
| β-strand | 142-143 | 2 | 1 |
| α-helix | 144-148 | 5 | |
| α-helix | 149-154 | 6 | |
| α-helix | 158-168 | 11 | |
| α-helix | 169-173 | 5 | |
| α-helix | 174-193 | 20 | |
| α-helix | 199-203 | 5 | |
| β-strand | 209 | 1 | 2 |
| β-strand | 217 | 1 | 2 |
| α-helix | 221-249 | 29 | |
| β-strand | 260 | 1 | 3 |
| α-helix | 261 | 1 | |
| β-strand | 262 | 1 | 4 |
| α-helix | 263 | 1 | |
| α-helix | 264-266 | 3 | |
| α-helix | 276-278 | 3 | |
| α-helix | 279-282 | 4 | |
| α-helix | 294-299 | 6 | |
| α-helix | 304-318 | 15 | |
| α-helix | 320-324 | 5 | |
| β-strand | 332 | 1 | 5 |
| β-strand | 347-350 | 4 | 5 |
| β-strand | 356-359 | 4 | 5 |
| α-helix | 366-385 | 20 | |
| α-helix | 390-392 | 3 | |
| α-helix | 400-413 | 14 | |
| α-helix | 415-420 | 6 | |
| α-helix | 432-464 | 33 | |
| α-helix | 473-483 | 11 | |
| β-strand | 487 | 1 | 4 |
| α-helix | 500-502 | 3 | |
| α-helix | 504-507 | 4 | |
| α-helix | 513-532 | 20 | |
| α-helix | 539-541 | 3 | |
| α-helix | 548-558 | 11 | |
| α-helix | 561-563 | 3 | |
| α-helix | 566-574 | 9 | |
| α-helix | 582-598 | 17 | |
| β-strand | 607 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 334-335 | 2 | 6 |
| α-helix | 338-342 | 5 | |
| β-strand | 349 | 1 | 7 |
| α-helix | 350-352 | 3 | |
| β-strand | 354-358 | 5 | 7 |
| β-strand | 361-362 | 2 | 6 |
| α-helix | 365-371 | 7 | |
| β-strand | 376-377 | 2 | 7 |
| β-strand | 380 | 1 | 7 |
| α-helix | 386-389 | 4 | |
| β-strand | 392 | 1 | 6 |
| β-strand | 395-403 | 9 | 7 |
| α-helix | 404-409 | 6 | |
| α-helix | 417-421 | 5 | |
| β-strand | 431-437 | 7 | 7 |
| α-helix | 439-442 | 4 | |
| β-strand | 448 | 1 | 8 |
| β-strand | 452-454 | 3 | 9 |
| α-helix | 460-462 | 3 | |
| α-helix | 471-472 | 2 | |
| β-strand | 473-474 | 2 | 10 |
| β-strand | 485 | 1 | 10 |
| β-strand | 488-489 | 2 | 10 |
| β-strand | 492-494 | 3 | 9 |
| β-strand | 497 | 1 | 8 |
| β-strand | 507-515 | 9 | 7 |
| β-strand | 524-525 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiotensin-converting enzyme | A | protein | 609 | Petaurus norfolcensis | A0A8D2KIZ1 (AlphaFold model) |
| Spike glycoprotein | E | protein | 194 | Pangolin coronavirus | Q6T1E4 |
>9JR7_1 Angiotensin-converting enzyme (chains A) MLGSSWILLSFVAVTAAQSTIEELAKTFLDKFNQEAEDLDHQRSLAAWNYNTNITKENTE KMNEAEAKWSAFYEEQSKLAKDYPLQEIQNFTLKRQLQALQQSGSSALSANKREQLNTIL NTMSTIYSTGKVCNPKKPQECLLLEPGLDEIMANSTDYSERLWVWEGWRSEVGKQLRPLY EEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYGYNRNQLIEDVERTFAEIKPLYEHL HAYVRAKLMNTYPSYISPTGCLPAHLLGDMWGRFWTNLYSLTVPFPEKPNIDVTDAMINQ NWNAVRIFKEAEKFFVSVGLPNMTQGFWENSMLTEPTDGRKVVCHPTAWDLQKGDFRIKM CTKVTMDNFLTAHHEMGHIQYDMAYAMQPYLLRNGANEGFHEAVGEIMSLSASTPKHLKS IGLLPSDFREDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM KREIVGVMEPVPHDETYCDPAALYHVSNDFSFIRYYTRTIYQFQFQEALCQAAKHEGPLH KCDISNSTEAGQKLLNMLRLGKSKPWTLALENVVGARNMDVRPLLNYFEPLFGWLKDQNR NSFVGWNTD
>9JR7_2 Spike glycoprotein (chains E) TNLCPFGEVFNASKFASVYAWNRKRISNCVADYSVLYNSTSFSTFKCYGVSPTKLNDLCF TNVYADSFVVKGDEVRQIAPGQTGVIADYNYKLPDDFTGCVIAWNSVKQDALTGGNYGYL YRLFRKSKLKPFERDISTEIYQAGSTPCNGQVGLNCYYPLERYGFHPTTGVNYQPFRVVV LSFELLNGPATVCG
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 5 |
Cross-species recognition of squirrel ACE2 by the receptor binding domains of SARS-CoV-2, RaTG13, PCoV-GD and PCoV-GX. Wang, C., Nan, X., Deng, Y. et al. Structure (2025) 33:1750-1759.e2. DOI 10.1016/j.str.2025.07.003 · PubMed
Other PDB entries of the same protein (UniProt A0A8D2KIZ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9JR7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.