G175S mutant native PMEL amyloid. Determined by electron microscopy at 1.79 Å resolution. Released 9 Oct 2024.
Explore 9JSV in 3D Show helices and sheets RCSB PDB PDBe
9JSV contains 0 α-helices and 28 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-163 | 14 | 1 |
| β-strand | 167-172 | 6 | 2 |
| β-strand | 175-179 | 5 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-153 | 4 | 4 |
| β-strand | 156-163 | 8 | 5 |
| β-strand | 167-172 | 6 | 6 |
| β-strand | 175-179 | 5 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| M-alpha | A, B, C, D, E, F, G, H | protein | 34 | Homo sapiens | P40967 (AlphaFold model) |
>9JSV_1 M-alpha (chains A, B, C, D, E, F, G, H) FVYVWKTWGQYWQVLGGPVSGLSIGTSRAMLGTH
Cryo-EM of wild-type and mutant PMEL amyloid cores reveals structural mechanism of pigment dispersion syndrome. Yanagisawa, H., Arai, H., Wang, T. et al. Nat Commun (2025) 16:5411-5411. DOI 10.1038/s41467-025-61233-y · PubMed
Other PDB entries of the same protein (UniProt P40967 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9JSV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.