9JSW: Wild-type PMEL CAF amyloid -in vitro polymerized

Wild-type PMEL CAF amyloid -in vitro polymerized. Determined by electron microscopy at 1.94 Å resolution. Released 9 Oct 2024.

Method: Electron microscopy
Resolution: 1.94 Å
Organism: Homo sapiens
Chains: 8
Atoms: 2,176
Mol. weight: 30.75 kDa
Released: 9 Oct 2024

Explore 9JSW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JSW contains 0 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G and H: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	149-164	16	1
β-strand	167-179	13	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M-alpha	A, B, C, D, E, F, G, H	protein	35	Homo sapiens	P40967 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>9JSW_1 M-alpha (chains A, B, C, D, E, F, G, H)
SFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTH

Primary citation

Cryo-EM of wild-type and mutant PMEL amyloid cores reveals structural mechanism of pigment dispersion syndrome. Yanagisawa, H., Arai, H., Wang, T. et al. Nat Commun (2025) 16:5411-5411. DOI 10.1038/s41467-025-61233-y · PubMed

Other PDB entries of the same protein (UniProt P40967 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EU5 1.54 Å, HLA Class I antigen
9JST 1.79 Å, Wild-type native PMEL amyloid - polymorph 1
9JSU 1.79 Å, Wild-type native PMEL amyloid - polymorph 2
9JSV 1.79 Å, G175S mutant native PMEL amyloid
9JSX 1.79 Å, G175S PMEL CAF amyloid - in vitro polymerized
1TVB 1.8 Å, Crystal structure of Melanoma Antigen gp100(209-217) Bound to Human Class I MHC HLA-A2
1TVH 1.8 Å, Crystal structure of Modified Melanoma Antigen gp100(209-T2M) Bound to Human Class I MHC…
3CC5 1.91 Å, H-2Db complex with human gp100
5EU3 1.97 Å, HLA Class I antigen
5EU6 2.02 Å, HLA Class I antigen
5EU4 2.12 Å, HLA Class I antigen
6VM7 2.41 Å, SILv44 T cell receptor bound to HLA-A2 presenting gp100 peptide (ITDQVPFSV)

Browse structure collections

About this viewer

MolViewer shows 9JSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.