9KMR: Human Hsp90-PINK1 complex

Human Hsp90-PINK1 complex. Determined by electron microscopy at 2.98 Å resolution. Released 15 Oct 2025.

Method: Electron microscopy
Resolution: 2.98 Å
Organism: Homo sapiens
Chains: 3
Atoms: 13,029
Mol. weight: 233.26 kDa
Ligands: ADP
Released: 15 Oct 2025

Explore 9KMR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KMR contains 71 α-helices and 65 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	18-19	2	1
β-strand	24	1	2
α-helix	26-35	10
α-helix	43-65	23
α-helix	68-70	3
β-strand	78-83	6	3
β-strand	88-93	6	3
α-helix	100-103	4
α-helix	104-108	5
β-strand	110	1	4
α-helix	114-121	8
α-helix	138-144	7
β-strand	145-153	9	3
β-strand	160-164	5	3
β-strand	170-174	5	3
β-strand	183-190	8	3
α-helix	192-198	7
α-helix	200-209	10
β-strand	218-220	3	3
β-strand	285-286	2	3
α-helix	293-295	3
α-helix	305-313	9
β-strand	322-329	8	5
β-strand	333-340	8	5
β-strand	357-362	6	5
β-strand	366-369	4	5
α-helix	372-374	3
α-helix	377-379	3
β-strand	383-388	6	5
β-strand	393	1	6
β-strand	400	1	6
α-helix	404-424	21
α-helix	429-448	20
α-helix	453-457	5
β-strand	461-462	2	7
β-strand	463-464	2	8
β-strand	472-473	2	7
α-helix	474-480	7
β-strand	487-492	6	8
α-helix	496-500	5
α-helix	505-511	7
β-strand	515-518	4	8
α-helix	522-527	6
β-strand	532-533	2	8
β-strand	536-540	5	8
β-strand	543	1	9
α-helix	552-574	23
β-strand	583-585	3	9
β-strand	594-598	5	9
α-helix	605-613	9
α-helix	619-624	6
β-strand	629-633	5	9
α-helix	638-649	12
α-helix	654-670	17
α-helix	673-675	3
α-helix	678-693	16

Chain B: 27 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	17-20	4	3
β-strand	24	1	4
α-helix	26-35	10
α-helix	43-65	23
α-helix	68-70	3
β-strand	78-83	6	1
β-strand	88-93	6	1
α-helix	100-103	4
α-helix	104-108	5
β-strand	110	1	2
α-helix	114-121	8
α-helix	138-144	7
β-strand	147-153	7	1
β-strand	160-164	5	1
β-strand	170-174	5	1
β-strand	183-189	7	1
α-helix	192-198	7
α-helix	200-209	10
β-strand	218-220	3	1
β-strand	285-286	2	1
α-helix	293-295	3
α-helix	305-313	9
β-strand	322-329	8	10
β-strand	333-340	8	10
β-strand	357-362	6	10
β-strand	366-369	4	10
α-helix	372-374	3
α-helix	377-379	3
β-strand	383-388	6	10
β-strand	393	1	11
β-strand	400	1	11
α-helix	404-424	21
α-helix	428-448	21
α-helix	453-457	5
β-strand	461-462	2	12
β-strand	463-464	2	13
β-strand	472-473	2	12
α-helix	474-480	7
β-strand	487-492	6	13
α-helix	496-500	5
α-helix	505-511	7
β-strand	515-518	4	13
α-helix	522-527	6
β-strand	532-533	2	13
β-strand	536-540	5	13
β-strand	543	1	14
α-helix	552-574	23
β-strand	583-585	3	14
β-strand	594-598	5	14
α-helix	605-613	9
α-helix	619-624	6
β-strand	629-633	5	14
α-helix	638-649	12
α-helix	654-670	17
α-helix	673-675	3
α-helix	678-693	16

Chain C: 17 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	162-164	3	15
β-strand	168-170	3	15
β-strand	173	1	16
β-strand	216	1	16
α-helix	230-239	10
α-helix	258-261	4
α-helix	288-289	2
α-helix	313-315	3
β-strand	323-324	2	17
α-helix	325-331	7
α-helix	336-354	19
β-strand	369-371	3	17
α-helix	377-378	2
β-strand	379-381	3	17
α-helix	434-446	13
α-helix	452-455	4
α-helix	480-489	10
α-helix	500-511	12
α-helix	520-522	3
α-helix	525-526	2
α-helix	528-538	11
α-helix	540-544	5
α-helix	549-558	10
α-helix	564-578	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-alpha	A, B	protein	732	Homo sapiens	P07900 (AlphaFold model)
Serine/threonine-protein kinase PINK1, mitochondrial	C	protein	581	Homo sapiens	Q9BXM7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9KMR_1 Heat shock protein HSP 90-alpha (chains A, B)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Sequence of entity 2 (C), FASTA

>9KMR_2 Serine/threonine-protein kinase PINK1, mitochondrial (chains C)
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVG
LGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRR
AVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQ
NLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQE
LVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP
SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAH
RDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST
ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPP
DVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLL
ANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAAL

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Human Hsp90-PINK1 complex. Tian, X.Y., Su, J.Y. To be published.

Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TN5 1.17 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
5J80 1.17 Å, Crystal Structure of Apo Hsp90-alpha N-domain L107A mutant
3T0H 1.2 Å, Structure insights into mechanisms of ATP hydrolysis and the activation of human Hsp90
5J2X 1.22 Å, Crystal Structure of Hsp90-alpha N-domain in complex with…
3T10 1.24 Å, HSP90 N-terminal domain bound to ACP
6TN4 1.27 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
3WHA 1.3 Å, Hsp90 alpha N-terminal domain in complex with a tricyclic inhibitor
5XRD 1.3 Å, Crystal Structure of the human Hsp90-alpha N-domain bound to the hsp90 inhibitor FS7
2YK9 1.32 Å, Tricyclic series of Hsp90 inhibitors
5LRL 1.33 Å, Crystal structure of HSP90 in complex with A003492875
6GR5 1.34 Å, Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant…
3B28 1.35 Å, Hsp90 alpha N-terminal domain in complex with an inhibitor CH5015765

Browse structure collections

About this viewer

MolViewer shows 9KMR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.