9KO6: C-C motif chemokine 19

A local Cryo_EM structure of CCR7 complex with CCL19. Determined by electron microscopy at 3.3 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,743
Mol. weight: 47.11 kDa
Released: 26 Nov 2025

Explore 9KO6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KO6 contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	41	1	1
β-strand	49	1	1
α-helix	56-66	11

Chain R: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	51-86	36
α-helix	92-119	28
α-helix	126-158	33
α-helix	169-189	21
α-helix	191-196	6
β-strand	197-200	4	2
β-strand	209-212	4	2
α-helix	217-228	12
α-helix	229-233	5
α-helix	234-252	19
α-helix	259-289	31
α-helix	298-315	18
α-helix	318-322	5
α-helix	323-327	5
α-helix	331-341	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 19	C	protein	69	Homo sapiens	Q99731 (AlphaFold model)
C-C chemokine receptor type 7	R	protein	344	Homo sapiens	P32248 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9KO6_1 C-C motif chemokine 19 (chains C)
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVER
IIQRLQRTS

Sequence of entity 2 (R), FASTA

>9KO6_2 C-C chemokine receptor type 7 (chains R)
QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYI
YFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGM
LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSS
EQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKV
IIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPF
LYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSV

Primary citation

A local Cryo_EM structure of CCR7 complex with CCL19. Yuan, Q., Duan, J., Cao, Y. To be published.

Other PDB entries of the same protein (UniProt Q99731 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7STA 2.5 Å, X-ray Crystal Structure of Truncated Human Chemokine CCL19 (7-70)
9KO2 2.98 Å, A Cryo_EM structure of CCR7 complex with CCL19
9XHH 3.0 Å, Structure of the CCL19-CCR7-Gi-scFv16 complex
2MP1 Solution structure of the human chemokine CCL19

Browse structure collections

About this viewer

MolViewer shows 9KO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.