Alpha-hemolysin heptameric pre-pore state bound to 10:PC lipid chains derived from 10:0 PC liposomes. Determined by electron microscopy at 2.9 Å resolution. Released 11 Jun 2025.
Explore 9KTM in 3D Show helices and sheets RCSB PDB PDBe
9KTM contains 28 α-helices and 175 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| β-strand | 22 | 1 | 12 |
| β-strand | 24 | 1 | 13 |
| β-strand | 27-28 | 2 | 14 |
| β-strand | 34-36 | 3 | 14 |
| β-strand | 39 | 1 | 13 |
| β-strand | 48 | 1 | 1 |
| β-strand | 53-56 | 4 | 15 |
| β-strand | 59-61 | 3 | 14 |
| β-strand | 66-69 | 4 | 16 |
| β-strand | 77-79 | 3 | 16 |
| β-strand | 80-87 | 8 | 17 |
| β-strand | 97-100 | 4 | 15 |
| α-helix | 104 | 1 | |
| β-strand | 155-158 | 4 | 17 |
| β-strand | 166-170 | 5 | 17 |
| α-helix | 206-208 | 3 | |
| α-helix | 218-222 | 5 | |
| β-strand | 224 | 1 | 14 |
| β-strand | 229-233 | 5 | 15 |
| β-strand | 248 | 1 | 18 |
| β-strand | 250-254 | 5 | 17 |
| β-strand | 256-257 | 2 | 19 |
| β-strand | 260 | 1 | 20 |
| β-strand | 265 | 1 | 20 |
| β-strand | 268-269 | 2 | 19 |
| β-strand | 279 | 1 | 18 |
| β-strand | 284-285 | 2 | 21 |
| β-strand | 290-291 | 2 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-hemolysin | A, B, C, D, E, F, G | protein | 293 | Staphylococcus aureus | Q2G1X0 (AlphaFold model) |
>9KTM_1 Alpha-hemolysin (chains A, B, C, D, E, F, G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGT IAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGF NGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWG PYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASK QQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
| ID | Name | Formula | Copies |
|---|---|---|---|
| P1O | 1,2-didecanoyl-sn-glycero-3-phosphocholine | C28 H57 N O8 P | 7 |
Structural insights into pre-pore intermediates of alpha-hemolysin in the lipidic environment. Chatterjee, A., Roy, A., Satheesh, T. et al. Nat Commun (2025) 16:6348-6348. DOI 10.1038/s41467-025-61741-x · PubMed
Other PDB entries of the same protein (UniProt Q2G1X0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9KTM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.