9LH5: Human alpha 7 nicotinic acetylcholine receptor

human alpha 7 nicotinic acetylcholine receptor in complex with L-nicotine (open state). Determined by electron microscopy at 2.61 Å resolution. Released 10 Sept 2025.

Method: Electron microscopy
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 5
Atoms: 15,930
Mol. weight: 294.24 kDa
Ligands: NAG, NCT
Released: 10 Sept 2025

Explore 9LH5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LH5 contains 70 α-helices and 75 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	24-33	10
α-helix	50	1
β-strand	51-66	16	1
β-strand	71-83	13	1
β-strand	99-102	4	1
β-strand	112-114	3	2
β-strand	117	1	1
β-strand	125	1	1
β-strand	130-133	4	1
β-strand	137-140	4	1
β-strand	143-149	7	1
β-strand	161-170	10	2
β-strand	178-182	5	1
β-strand	186	1	1
β-strand	196-200	5	2
β-strand	203-208	6	2
β-strand	217-228	12	2
α-helix	231-233	3
α-helix	234-238	5
α-helix	239-253	15
α-helix	255-256	2
α-helix	259-275	17
α-helix	277-280	4
α-helix	292-312	21
α-helix	313-317	5
α-helix	329-341	13
α-helix	432-487	56
α-helix	494-496	3
α-helix	497-501	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal acetylcholine receptor subunit alpha-7	A, B, C, D, E	protein	512	Homo sapiens	P36544 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>9LH5_1 Neuronal acetylcholine receptor subunit alpha-7 (chains A, B, C, D, E)
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFAGGDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5
NCT	(s)-3-(1-methylpyrrolidin-2-yl)pyridine	C10 H14 N2	5

Primary citation

Structural insights into the progressive recovery of alpha 7 nicotinic acetylcholine receptor from nicotine-induced desensitization. Liu, S., Chen, H., Zhu, X. et al. Sci Adv (2025) 11:eadx4432-eadx4432. DOI 10.1126/sciadv.adx4432 · PubMed

Other PDB entries of the same protein (UniProt P36544 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
5AFN 2.15 Å, alpha7-AChBP in complex with lobeline and fragment 5
9QTO 2.16 Å, Human alpha7 nicotinic receptor in complex with the E6 nanobody
8V8A 2.19 Å, Alpha7-nicotinic acetylcholine receptor time resolved bound to epibatidine and…
5AFJ 2.2 Å, alpha7-AChBP in complex with lobeline and fragment 1
9QTN 2.28 Å, Human alpha7 nicotinic receptor in complex with the F1 nanobody
8C9X 2.3 Å, human alpha7 nicotinic receptor in complex with the C4 nanobody
8UT1 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine
8UTB 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and NS-1738
8UZJ 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and ivermectin
8V88 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and GAT107
8V80 2.34 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and (-)-TQS

Browse structure collections

About this viewer

MolViewer shows 9LH5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.