9LZ2: PTH1R(V2RC)-beta-arrestin1 complex

Cryo-EM structure of PTH1R(V2RC)-beta-arrestin1 complex. Determined by electron microscopy at 3.0 Å resolution. Released 11 Mar 2026.

Method: Electron microscopy
Resolution: 3.0 Å
Organisms: synthetic construct, Bos taurus, Mus musculus
Chains: 5
Atoms: 7,117
Mol. weight: 146.13 kDa
Released: 11 Mar 2026

Explore 9LZ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LZ2 contains 27 α-helices and 51 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-28	3	2
α-helix	29-30	2
β-strand	39-43	5	1
β-strand	52	1	3
β-strand	53-62	10	4
β-strand	77-87	11	4
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-115	4	1
β-strand	127-129	3	4
α-helix	130-132	3
α-helix	139	1
β-strand	141-148	8	4
β-strand	151	1	3
α-helix	160-162	3
β-strand	166-168	3	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-189	7	5
β-strand	196-203	8	5
β-strand	207-208	2	6
β-strand	214-222	9	5
β-strand	228-242	15	7
β-strand	246-252	7	7
β-strand	256-258	3	7
β-strand	262	1	7
β-strand	267-274	8	5
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-303	3
β-strand	318-329	12	7
β-strand	342-349	8	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain H: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	8
β-strand	13-15	3	9
β-strand	21-28	8	8
β-strand	35-42	8	10
β-strand	48-55	8	10
β-strand	60-63	4	10
β-strand	71-76	6	8
β-strand	81-86	6	8
α-helix	91-93	3
β-strand	95-97	3	9
β-strand	98-103	6	10
β-strand	110-113	4	10
β-strand	117-121	5	9

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	11
β-strand	11-13	3	12
β-strand	20-25	6	11
β-strand	34-39	6	12
β-strand	46-50	5	12
β-strand	54-55	2	12
α-helix	56	1
β-strand	63-68	6	11
β-strand	71-76	6	11
β-strand	86-91	6	12
α-helix	97	1
β-strand	99	1	12
β-strand	103-106	4	12

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-31	29

Chain R: 13 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	179-211	33
α-helix	213-215	3
α-helix	218-244	27
α-helix	279-311	33
α-helix	317-342	26
α-helix	343-347	5
α-helix	361-391	31
α-helix	400-417	18
α-helix	435-449	15
α-helix	451-456	6
α-helix	457-461	5
α-helix	464-480	17
α-helix	1357-1359	3
β-strand	1361-1364	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Long-acting PTH	P	protein	36	synthetic construct
Beta-arrestin-1	A	protein	393	Bos taurus	P17870 (AlphaFold model)
Fab30 heavy chain	H	protein	160	Mus musculus
Fab30 light chain	L	protein	215	Mus musculus
Parathyroid hormone/parathyroid hormone-related peptide receptor,Vasopressin V2 receptor	R	protein	500	Homo sapiens	P30518 (AlphaFold model), Q03431 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>9LZ2_1 Long-acting PTH (chains P)
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI

Sequence of entity 2 (A), FASTA

>9LZ2_2 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDIVFEDFAR

Sequence of entity 3 (H), FASTA

>9LZ2_3 Fab30 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV

Sequence of entity 4 (L), FASTA

>9LZ2_4 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (R), FASTA

>9LZ2_5 Parathyroid hormone/parathyroid hormone-related peptide receptor,Vasopressin V2 receptor (chains R)
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGK
LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR
RCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLAMIYTVGYSVSLASLTVAV
LILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQ
APPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTV
FGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLA
TKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEML
FNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGGGGSGGGSGGARGREP
PELGPQDESCTTASSSLAKD

Primary citation

Core conformation of arrestin coupling to parathyroid hormone type 1 receptor. Zhai, X., Guo, J., Shen, Q. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-72448-y · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 9LZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.