9M4Q: Alpha1AAR complex with doxazosin

CryoEM structure of the alpha1AAR complex with doxazosin. Determined by electron microscopy at 2.99 Å resolution. Released 2 Jul 2025.

Method: Electron microscopy
Resolution: 2.99 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,210
Mol. weight: 36.24 kDa
Ligands: A1EM4
Released: 2 Jul 2025

Explore 9M4Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9M4Q contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	24-53	30
α-helix	60-74	15
α-helix	75-79	5
α-helix	80-89	10
α-helix	96-129	34
α-helix	134-137	4
α-helix	140-159	20
α-helix	167-170	4
α-helix	182-189	8
α-helix	190-194	5
α-helix	195-213	19
α-helix	262-297	36
α-helix	305-329	25
α-helix	331-340	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-1A adrenergic receptor	A	protein	323	Homo sapiens	P35348 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9M4Q_1 Alpha-1A adrenergic receptor (chains A)
APVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTST
VLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIV
TQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLA
IILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFS
VRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLN
SCINPIIYPCSSQEFKKAFQNVL

Ligands and cofactors

ID	Name	Formula	Copies
A1EM4	Doxazosin, (S)-	C23 H25 N5 O5	1

Primary citation

Molecular mechanism of antagonist recognition and regulation of the alpha 1A -adrenoceptor. Liu, S., Jiao, H., Tao, Y. et al. J Biol Chem (2025) 301:110348-110348. DOI 10.1016/j.jbc.2025.110348 · PubMed

Other PDB entries of the same protein (UniProt P35348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8THK 2.6 Å, Cryo-EM structure of A61603-bound alpha-1A-adrenergic receptor in complex with…
8HN1 2.9 Å, Cryo-EM structure of AdTx1-alpha1AAR-Nb6
7YM8 2.92 Å, Cryo-EM structure of Nb29-alpha1AAR-miniGsq complex bound to oxymetazoline
8THL 3.1 Å, Cryo-EM structure of epinephrine-bound alpha-1A-adrenergic receptor in complex with…
9M4T 3.19 Å, CryoEM structure of the alpha1AAR complex with silodosin
9IQV 3.3 Å, Cryo-EM structure of MT3-alpha1AAR
7YMJ 3.35 Å, Cryo-EM structure of alpha1AAR-Nb6 complex bound to tamsulosin
7YMH 3.52 Å, Cryo-EM structure of Nb29-alpha1AAR-miniGsq complex bound to noradrenaline

Browse structure collections

About this viewer

MolViewer shows 9M4Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.