9M73: MBP-fused BIL1/BZR1

Crystal structure of MBP-fused BIL1/BZR1 (21-104) in complex with double-stranded DNA contaning CACATATGTG. Determined by X-ray diffraction at 2.31 Å resolution. Released 10 Sept 2025.

Method: X-ray diffraction
Resolution: 2.31 Å
Organisms: Arabidopsis thaliana, synthetic construct
Chains: 8
Atoms: 15,075
Mol. weight: 219.33 kDa
Released: 10 Sept 2025

Explore 9M73 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9M73 contains 109 α-helices and 102 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	-342--338	5	20
α-helix	-331--317	15
β-strand	-314--310	5	20
α-helix	-305--296	10
β-strand	-289--285	5	20
α-helix	-284--282	3
α-helix	-281--276	6
β-strand	-272	1	21
α-helix	-265--262	4
β-strand	-259	1	22
α-helix	-257--252	6
β-strand	-250--249	2	23
β-strand	-246--245	2	23
β-strand	-242--237	6	20
β-strand	-234--230	5	24
β-strand	-220	1	25
α-helix	-216--207	10
β-strand	-203--201	3	24
α-helix	-194--192	3
α-helix	-190--185	6
β-strand	-181--176	6	26
β-strand	-173--166	8	26
α-helix	-162--148	15
α-helix	-138--130	9
β-strand	-126--121	6	24
α-helix	-119--117	3
α-helix	-116--111	6
β-strand	-106--103	4	24
α-helix	-102--100	3
β-strand	-99	1	25
β-strand	-98	1	27
β-strand	-95	1	27
α-helix	-94--93	2
α-helix	-91	1
β-strand	-90--89	2	28
β-strand	-88--82	7	20
β-strand	-81	1	21
α-helix	-75--70	6
α-helix	-69--64	6
α-helix	-61--52	10
β-strand	-47--46	2	20
β-strand	-44	1	22
α-helix	-43--37	7
α-helix	-33--22	12
β-strand	-20--19	2	28
α-helix	-18--17	2
α-helix	-12-3	16
α-helix	9-20	12
α-helix	23-26	4
α-helix	27-55	29
α-helix	65-75	11
β-strand	79-80	2	29
β-strand	86-87	2	29

Chain B: 27 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	-342--338	5	30
α-helix	-331--317	15
β-strand	-314--310	5	30
α-helix	-305--296	10
β-strand	-289--285	5	30
α-helix	-284--282	3
α-helix	-281--276	6
β-strand	-272	1	31
α-helix	-271--269	3
α-helix	-265--262	4
β-strand	-259	1	32
α-helix	-257--252	6
β-strand	-250--249	2	33
β-strand	-246--245	2	33
β-strand	-242--237	6	30
β-strand	-234--230	5	34
β-strand	-220	1	35
α-helix	-216--208	9
β-strand	-203--201	3	34
α-helix	-194--185	10
β-strand	-181--176	6	36
β-strand	-173--166	8	36
α-helix	-162--148	15
α-helix	-138--130	9
β-strand	-126--121	6	34
α-helix	-119--117	3
α-helix	-116--111	6
β-strand	-106--103	4	34
α-helix	-102--100	3
β-strand	-99--98	2	35
β-strand	-95--94	2	35
α-helix	-93	1
α-helix	-91	1
β-strand	-90--89	2	37
β-strand	-88--82	7	30
β-strand	-81	1	31
α-helix	-75--70	6
α-helix	-69--64	6
α-helix	-61--52	10
β-strand	-47--46	2	30
β-strand	-44	1	32
α-helix	-43--37	7
α-helix	-33--22	12
β-strand	-20--19	2	37
α-helix	-18--17	2
α-helix	-12-4	17
α-helix	9-21	13
α-helix	24-26	3
α-helix	27-54	28
α-helix	65-75	11
β-strand	79-80	2	38
β-strand	86-87	2	38

Chain C: 27 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	-342--338	5	1
α-helix	-331--317	15
β-strand	-314--310	5	1
α-helix	-305--297	9
β-strand	-289--285	5	1
α-helix	-284--282	3
α-helix	-281--276	6
β-strand	-272	1	2
α-helix	-271--269	3
α-helix	-265--262	4
β-strand	-259	1	3
α-helix	-257--252	6
β-strand	-250--249	2	4
β-strand	-246--245	2	4
β-strand	-242--237	6	1
β-strand	-234--230	5	5
β-strand	-220	1	6
α-helix	-216--207	10
β-strand	-203--201	3	5
α-helix	-194--192	3
α-helix	-190--185	6
β-strand	-181--176	6	7
β-strand	-173--166	8	7
α-helix	-162--148	15
α-helix	-138--129	10
β-strand	-126--121	6	5
α-helix	-119--117	3
α-helix	-116--111	6
β-strand	-106--103	4	5
α-helix	-102--100	3
β-strand	-99--98	2	6
β-strand	-95--94	2	6
α-helix	-91	1
β-strand	-90--89	2	8
β-strand	-88--82	7	1
β-strand	-81	1	2
α-helix	-75--69	7
α-helix	-68--64	5
α-helix	-61--52	10
β-strand	-47--46	2	1
β-strand	-44	1	3
α-helix	-43--37	7
α-helix	-33--22	12
β-strand	-20--19	2	8
α-helix	-18--17	2
α-helix	-12-4	17
α-helix	9-21	13
α-helix	24-26	3
α-helix	27-54	28
α-helix	65-75	11
β-strand	79-80	2	9
β-strand	86-87	2	9

Chain D: 28 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	-342--338	5	10
α-helix	-331--317	15
β-strand	-314--310	5	10
α-helix	-305--298	8
α-helix	-297--295	3
β-strand	-289--285	5	10
α-helix	-284--282	3
α-helix	-281--276	6
β-strand	-272	1	11
α-helix	-271--269	3
α-helix	-265--261	5
β-strand	-259	1	12
α-helix	-257--252	6
β-strand	-250--249	2	13
β-strand	-246--245	2	13
β-strand	-242--237	6	10
β-strand	-234--230	5	14
β-strand	-220	1	15
α-helix	-216--207	10
β-strand	-203--201	3	14
α-helix	-194--185	10
β-strand	-181--176	6	16
β-strand	-173--166	8	16
α-helix	-162--148	15
α-helix	-138--130	9
β-strand	-126--121	6	14
α-helix	-119--117	3
α-helix	-116--111	6
β-strand	-106--103	4	14
α-helix	-102--100	3
β-strand	-99	1	15
β-strand	-98	1	17
β-strand	-95	1	17
α-helix	-94--93	2
α-helix	-91	1
β-strand	-90--89	2	18
β-strand	-88--82	7	10
β-strand	-81	1	11
α-helix	-75--69	7
α-helix	-68--64	5
α-helix	-61--52	10
β-strand	-47--46	2	10
β-strand	-44	1	12
α-helix	-43--37	7
α-helix	-33--22	12
β-strand	-20--19	2	18
α-helix	-18--17	2
α-helix	-12-3	16
α-helix	9-19	11
α-helix	22-26	5
α-helix	27-54	28
α-helix	65-75	11
β-strand	79-80	2	19
β-strand	86-87	2	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltodextrin-binding protein,Protein BRASSINAZOLE-RESISTANT 1	A, B, C, D	protein	453	Arabidopsis thaliana	Q8S307 (AlphaFold model)
E-box(CATATG)-containing DNA	E, F, G, H	DNA	15	synthetic construct

Sequence of entity 1 (A, B, C, D), FASTA

>9M73_1 Maltodextrin-binding protein,Protein BRASSINAZOLE-RESISTANT 1 (chains A, B, C, D)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKA
LCVEAGWVVEEDGTTYRKGCKPLPGEIAGTSSR

Sequence of entity 2 (E, F, G, H), FASTA

>9M73_2 E-box(CATATG)-containing DNA (chains E, F, G, H)
TTCACATATGTGAAA

Primary citation

Single cis-elements in brassinosteroid-induced upregulated genes are insufficient to recruit both redox states of the BIL1/BZR1 DNA-binding domain. Nosaki, S., Ohtsuka, M., Nakano, T. et al. FEBS Lett (2025) 599:3369-3380. DOI 10.1002/1873-3468.70147 · PubMed

Other PDB entries of the same protein (UniProt Q8S307 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QTF 1.9 Å, Crystal structure of a C-terminally truncated version of Arabidopsis thaliana 14-3-3…
7VN3 1.94 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…
7VN5 1.95 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…
7VN8 2.04 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…
7VN4 2.1 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…
7VN7 2.11 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…
5ZD4 2.17 Å, Crystal structure of MBP-fused BIL1/BZR1 in complex with double-stranded DNA
9M74 2.23 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-104) in complex with double-stranded DNA…
7VN2 2.42 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…
8QT5 2.69 Å, Crystal structure of Arabidopsis thaliana 14-3-3 isoform lambda in complex with a…
7VN6 2.79 Å, Crystal structure of MBP-fused BIL1/BZR1 (21-90) in complex with double-stranded DNA…

Browse structure collections

About this viewer

MolViewer shows 9M73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.