9M9P: Glycogen phosphorylase dimer from E. coli

Glycogen phosphorylase dimer from E. coli. Determined by electron microscopy at 2.93 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 2.93 Å
Organism: Escherichia coli BL21(DE3)
Chains: 1
Atoms: 6,465
Mol. weight: 95.55 kDa
Released: 18 Feb 2026

Explore 9M9P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9M9P contains 44 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 44 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	16-23	8
α-helix	24-29	6
α-helix	38-66	29
β-strand	71-75	5	1
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	117-118	2
α-helix	124-140	17
β-strand	144-149	6	1
β-strand	157-161	5	2
β-strand	164-168	5	2
β-strand	180-192	13	1
β-strand	195-199	5	3
β-strand	202-206	5	3
β-strand	209-221	13	1
β-strand	228-238	11	1
α-helix	242-245	4
α-helix	252-254	3
α-helix	264-266	3
α-helix	279-302	24
α-helix	311-314	4
β-strand	315-319	5	1
α-helix	324-326	3
α-helix	327-339	13
α-helix	343-353	11
β-strand	354-357	4	1
β-strand	368-370	3	4
α-helix	371-377	7
α-helix	379-399	21
α-helix	404-410	7
β-strand	413-414	2	4
β-strand	420-422	3	4
α-helix	423-429	7
β-strand	433-436	4	1
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	1
β-strand	468	1	5
α-helix	479-489	11
α-helix	497-504	8
α-helix	509-535	27
β-strand	544-549	6	6
β-strand	552	1	7
α-helix	558-574	17
α-helix	580-582	3
β-strand	583-588	6	6
α-helix	590	1
β-strand	591	1	7
α-helix	592	1
α-helix	596-612	17
β-strand	622-626	5	6
α-helix	632-638	7
α-helix	639-641	3
β-strand	644-647	4	6
α-helix	649-650	2
α-helix	658-666	9
β-strand	669-672	4	6
α-helix	677-685	9
β-strand	691-692	2	6
α-helix	697-706	10
α-helix	710-716	7
α-helix	718-729	12
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	5
α-helix	796-803	8
α-helix	804-808	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-1,4 glucan phosphorylase	A	protein	832	Escherichia coli BL21(DE3)	P0AC86 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9M9P_1 Alpha-1,4 glucan phosphorylase (chains A)
MGSSHHHHHHENLYFQGMNAPFTYSSPTLSVEALKHSIAYKLMFTIGKDPVVANKHEWLN
ATLFAVRDRLVERWLRSNRAQLSQETRQVYYLSMEFLIGRTLSNAMLSLGIYEDVQGALE
AMGLNLEELIDEENDPGLGNGGLGRLAACFLDSLATLGLPGRGYGIRYDYGMFKQNIVNG
SQKESPDYWLEYGNPWEFKRHNTRYKVRFGGRIQQEGKKTRWIETEEILGVAYDQIIPGY
DTDATNTLRLWSAQASSEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRL
RQEYFLVSSTIQDILSRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSW
DDAFEVCCQVFSYTNHTLMSEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPND
TDLLGRASIIDESNGRRVRMAWLAVVVSHKVNGVSELHSNLMVQSLFADFAKIFPGRFTN
VTNGVTPRRWLAVANPSLSAVLDEHLGRNWRTDLSLLNELQQHCDFPMVNHAVHQAKLEN
KKRLAEYIAQQLNVVVNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPDAKWVPR
VNIFGGKAASAYYMAKHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAAD
LSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEEL
RRQGYKPREYYEKDEELHQVLTQIGSGVFSPEDPGRYRDLVDSLINFGDHYQVLADYRSY
VDCQDKVDELYELQEEWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDPVRL

Primary citation

Structural and mechanistic diversity of glycogen phosphorylases from gut bacteria. Shobu, K., Takai, M., Tanino, H. et al. Proc Natl Acad Sci U S A (2026) 123:e2518513123-e2518513123. DOI 10.1073/pnas.2518513123 · PubMed

Other PDB entries of the same protein (UniProt P0AC86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
9S86 2.97 Å, Structure of glycogen phosphorylase - tetrameric form - from Escherichia coli
9S7V 3.1 Å, Structure of glycogen phosphorylase - dimeric form - from Escherichia coli
9V16 3.45 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant in complex with AMP
9UKQ 3.5 Å, Crystal structure of glycogen phosphorylase from Escherichia coli
9UKR 3.55 Å, Crystal structure of glycogen phosphorylase from E. coli in complex with AMP
9V17 3.7 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant

Browse structure collections

About this viewer

MolViewer shows 9M9P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.