9MFG: Complex of IL23 receptor and VHH

Complex of IL23 receptor and VHH. Determined by X-ray diffraction at 2.85 Å resolution. Released 21 May 2025.

Method: X-ray diffraction
Resolution: 2.85 Å
Organisms: Homo sapiens, Lama glama
Chains: 8
Atoms: 13,510
Mol. weight: 202.84 kDa
Ligands: SCN, NAG
Released: 21 May 2025

Explore 9MFG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MFG contains 33 α-helices and 150 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	1
β-strand	41-43	3	2
β-strand	48-54	7	1
β-strand	63-68	6	2
β-strand	71-73	3	2
β-strand	77-79	3	1
β-strand	84-89	6	1
β-strand	96-104	9	2
β-strand	111-122	12	2
α-helix	124-128	5
β-strand	129-136	8	3
β-strand	141-147	7	3
β-strand	156-164	9	4
β-strand	170-175	6	4
β-strand	179-182	4	3
α-helix	183-185	3
β-strand	191-200	10	4
β-strand	203-206	4	4
α-helix	207-209	3
β-strand	210-213	4	4
α-helix	214-216	3
β-strand	218-219	2	3
β-strand	223-227	5	5
β-strand	239-244	6	5
β-strand	251-259	9	6
β-strand	266-269	4	6
β-strand	278-281	4	5
β-strand	289-298	10	6
α-helix	306-310	5
β-strand	311-314	4	6

Chain B: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	7
β-strand	41-43	3	8
β-strand	46-54	9	7
β-strand	63-68	6	8
β-strand	71-73	3	8
β-strand	77-81	5	7
β-strand	84-92	9	7
β-strand	96-104	9	8
β-strand	111-122	12	8
α-helix	124-128	5
β-strand	129-136	8	9
β-strand	141-147	7	9
β-strand	157-164	8	10
β-strand	172-175	4	10
β-strand	179-182	4	9
α-helix	183-185	3
β-strand	191-200	10	10
β-strand	203-206	4	10
α-helix	207-209	3
β-strand	210-213	4	10
β-strand	218-219	2	9
α-helix	220	1
α-helix	222	1
β-strand	223-231	9	11
β-strand	237-244	8	11
β-strand	251	1	12
β-strand	254-259	6	13
β-strand	266-269	4	13
β-strand	278-282	5	11
β-strand	288-295	8	13
β-strand	298	1	12
α-helix	305-310	6
β-strand	311-315	5	13

Chain C: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	7
β-strand	41-43	3	14
β-strand	46-54	9	7
β-strand	63-68	6	14
β-strand	72-73	2	14
β-strand	77-78	2	7
β-strand	84-92	9	7
β-strand	96-104	9	14
β-strand	111-122	12	14
α-helix	124-128	5
β-strand	129-136	8	15
β-strand	141-147	7	15
β-strand	156-164	9	16
β-strand	170-175	6	16
β-strand	179-182	4	15
α-helix	183-185	3
β-strand	191-200	10	16
β-strand	203-206	4	16
α-helix	207-209	3
β-strand	210-213	4	16
β-strand	218-219	2	15
α-helix	220	1
α-helix	222	1
β-strand	223-231	9	17
α-helix	232	1
β-strand	237-244	8	17
β-strand	251-259	9	18
β-strand	268-269	2	18
β-strand	278-282	5	17
β-strand	289-298	10	18
α-helix	305-310	6
β-strand	311-314	4	18

Chain D: 7 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	1
β-strand	41-43	3	19
β-strand	48-54	7	1
β-strand	63-68	6	19
β-strand	71-73	3	19
β-strand	77-79	3	1
β-strand	84-89	6	1
β-strand	96-104	9	19
β-strand	111-122	12	19
α-helix	124-128	5
β-strand	129-134	6	20
β-strand	135-136	2	21
β-strand	141-147	7	20
β-strand	156-164	9	22
β-strand	170-175	6	22
β-strand	179-182	4	20
α-helix	183-185	3
β-strand	191-200	10	22
β-strand	203-206	4	22
α-helix	207-209	3
β-strand	210-213	4	22
β-strand	218-219	2	21
α-helix	220	1
α-helix	222	1
β-strand	223-230	8	23
β-strand	238-244	7	23
β-strand	251-259	9	24
β-strand	266-272	7	24
β-strand	278-282	5	23
β-strand	289-298	10	24
α-helix	305-309	5
β-strand	311-314	4	24
α-helix	315-316	2

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	25
β-strand	10-12	3	19
β-strand	18-25	8	25
β-strand	33-39	7	19
β-strand	46-51	6	19
β-strand	57-59	3	19
β-strand	67-72	6	25
α-helix	73-75	3
β-strand	77-82	6	25
α-helix	87-89	3
β-strand	91-98	8	19
β-strand	109-110	2	19
β-strand	114-118	5	19

Chain F: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	26
β-strand	10-12	3	14
β-strand	18-25	8	26
α-helix	29-31	3
β-strand	33-39	7	14
β-strand	46-51	6	14
β-strand	57-59	3	14
β-strand	64	1	26
β-strand	67-72	6	26
α-helix	73-75	3
β-strand	77-82	6	26
α-helix	87-89	3
β-strand	91-98	8	14
β-strand	109-110	2	14
β-strand	114-118	5	14

Chain G: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	27
β-strand	10-12	3	2
β-strand	18-25	8	27
α-helix	29-31	3
β-strand	33-39	7	2
β-strand	46-51	6	2
β-strand	57-59	3	2
β-strand	67-72	6	27
β-strand	77-82	6	27
α-helix	87-89	3
β-strand	91-98	8	2
β-strand	107-110	4	2
β-strand	114-118	5	2

Chain H: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	28
β-strand	11-12	2	29
β-strand	17-25	9	28
β-strand	33-39	7	8
β-strand	45-51	7	8
β-strand	57-59	3	8
β-strand	64	1	28
β-strand	67-72	6	28
β-strand	77-83	7	28
α-helix	87-89	3
β-strand	91-98	8	8
β-strand	109-110	2	8
β-strand	114-116	3	8
β-strand	117-118	2	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-23 receptor	A, B, C, D	protein	304	Homo sapiens	Q5VWK5 (AlphaFold model)
VHH	E, F, G, H	protein	120	Lama glama

Sequence of entity 1 (A, B, C, D), FASTA

>9MFG_1 Interleukin-23 receptor (chains A, B, C, D)
GSITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINK
TTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNM
TCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANAL
GMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTN
QTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPEGNSHH
HHHH

Sequence of entity 2 (E, F, G, H), FASTA

>9MFG_2 VHH (chains E, F, G, H)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMAWFRQAPGKEREFVAESWSSGTTYYG
ASVVGRFTMSRDDSKNTVYLQMNSLRAEDTAVYYCAAKRPDAGWQTYDYWGQGTLVTVSS

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	5
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

Engineering a protease-stable, oral single-domain antibody to inhibit IL-23 signaling. Ota, N., Davies, C.W., Kang, J. et al. Proc Natl Acad Sci U S A (2025) 122:e2501635122-e2501635122. DOI 10.1073/pnas.2501635122 · PubMed

Other PDB entries of the same protein (UniProt Q5VWK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
6WDQ 3.4 Å, IL23/IL23R/IL12Rb1 signaling complex
8OE4 3.6 Å, Cryo-EM structure of a pre-dimerized human IL-23 complete extracellular signaling complex.

Browse structure collections

About this viewer

MolViewer shows 9MFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.