6WDQ: IL23/IL23R/IL12Rb1 signaling complex

IL23/IL23R/IL12Rb1 signaling complex. Determined by X-ray diffraction at 3.4 Å resolution. Released 24 Feb 2021.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,845
Mol. weight: 116.49 kDa
Ligands: NAG
Released: 24 Feb 2021

Explore 6WDQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WDQ contains 21 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
β-strand	30-37	8	1
β-strand	44-49	6	2
β-strand	60-62	3	1
β-strand	74-79	6	2
α-helix	82-84	3
β-strand	86-92	7	1
β-strand	95-108	14	1
β-strand	111-112	2	1
β-strand	117	1	1
β-strand	130-132	3	1
β-strand	133	1	3
β-strand	139-146	8	1
β-strand	152-160	9	1
α-helix	165	1
β-strand	166-170	5	1
β-strand	174-180	7	1
β-strand	185-195	11	1
α-helix	207	1
β-strand	208-216	9	1
β-strand	219-227	9	1
α-helix	229-232	4
β-strand	233	1	3
α-helix	235-238	4
β-strand	239-246	8	4
β-strand	251-257	7	4
β-strand	271-278	8	5
β-strand	289-291	3	5
β-strand	295-299	5	4
β-strand	305-312	8	5
α-helix	318-322	5
β-strand	323-326	4	5

Chain B: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	29-47	19
α-helix	52-54	3
β-strand	56-57	2	6
α-helix	79-84	6
α-helix	87-104	18
α-helix	114-116	3
α-helix	120-135	16
α-helix	155-186	32

Chain C: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	7
β-strand	41-43	3	6
β-strand	48-54	7	7
β-strand	64-68	5	6
β-strand	71-72	2	6
β-strand	77-81	5	7
β-strand	84-89	6	7
β-strand	96-104	9	6
β-strand	111-122	12	6
α-helix	124-126	3
β-strand	129-136	8	8
α-helix	137-139	3
β-strand	141-147	7	8
β-strand	157-164	8	9
β-strand	170-175	6	9
β-strand	179-182	4	8
α-helix	183-185	3
β-strand	191-200	10	9
β-strand	203-206	4	9
α-helix	207-209	3
β-strand	210-213	4	9
β-strand	218-219	2	8
α-helix	220-222	3
β-strand	223-231	9	10
β-strand	237-244	8	10
β-strand	251-259	9	11
β-strand	266-270	5	11
β-strand	278-283	6	10
β-strand	290-298	9	11
α-helix	305-310	6
β-strand	311-312	2	11

Chain D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	12
β-strand	46-54	9	13
β-strand	59-67	9	13
β-strand	74-80	7	12
β-strand	86-92	7	12
β-strand	96-100	5	13
β-strand	111-118	8	12
β-strand	123-125	3	12
α-helix	126-128	3
β-strand	129-131	3	12
α-helix	134-136	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A	protein	308	Homo sapiens	P29460 (AlphaFold model)
Interleukin-23 subunit alpha	B	protein	171	Homo sapiens	Q9NPF7 (AlphaFold model)
Interleukin-23 receptor	C	protein	307	Homo sapiens	Q5VWK5 (AlphaFold model)
Interleukin-12 receptor subunit beta-1	D	protein	219	Homo sapiens	P42701 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WDQ_1 Interleukin-12 subunit beta (chains A)
VAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK
EFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRF
TCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACP
AAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPD
TWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWS
EWASVPCS

Sequence of entity 2 (B), FASTA

>6WDQ_2 Interleukin-23 subunit alpha (chains B)
PAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQ
FCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQI
PSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPGTKHHHHHH

Sequence of entity 3 (C), FASTA

>6WDQ_3 Interleukin-23 receptor (chains C)
GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKT
TARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMT
CTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALG
MEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQ
TWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSPFFHKTPEIEGRGT
KHHHHHH

Sequence of entity 4 (D), FASTA

>6WDQ_4 Interleukin-12 receptor subunit beta-1 (chains D)
SECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRC
CYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDI
KVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQ
EFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Structural basis for IL-12 and IL-23 receptor sharing reveals a gateway for shaping actions on T versus NK cells. Glassman, C.R., Mathiharan, Y.K., Jude, K.M. et al. Cell (2021) 184:983-999.e24. DOI 10.1016/j.cell.2021.01.018 · PubMed

Other PDB entries of the same protein (UniProt P29460 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
8CR8 2.0 Å, human Interleukin-23
3DUH 2.3 Å, Structure of Interleukin-23
8UUI 2.43 Å, X-ray structure of Interleukin-23 in complex with peptide 23-446
1F42 2.5 Å, The P40 domain of human interleukin-12
5MXA 2.5 Å, Structure of unbound Interleukin-23
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
6UIB 2.74 Å, Crystal structure of IL23 bound to peptide 23-652
1F45 2.8 Å, Human interleukin-12
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23

Browse structure collections

About this viewer

MolViewer shows 6WDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.