9MN2: IgA FC receptor

Crystal Structure of the B6C Region of the Group B Streptococcus Beta Antigen C Protein. Determined by X-ray diffraction at 2.05 Å resolution. Released 27 Aug 2025.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Streptococcus agalactiae
Chains: 2
Atoms: 2,558
Mol. weight: 39.88 kDa
Released: 27 Aug 2025

Explore 9MN2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MN2 contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	259-302	44
α-helix	307-326	20
α-helix	328-380	53
α-helix	385-407	23

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	258-303	46
α-helix	307-380	74
α-helix	385-408	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgA FC receptor	A, B	protein	172	Streptococcus agalactiae	P27951 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9MN2_1 IgA FC receptor (chains A, B)
GSKAGLDQEIQEHVKKETSSEENTQKVDEHYANSLQNLAQKSLEELDKATTNEQATQVKN
QFLENAQKLKEIQPLIKETNVKLYKAMSESLEQVEKELKHNSEANLEDLVAKSKEIVREY
EGKLNQSKNLPELKQLEEEAHSKLKQVVEDFRKKFKTSEQVTPKKRVKRDLA

Primary citation

Bacterial targeting of the neutrophil inhibitory receptor LILRB3 to evade antibody immunity. Rumpret, M., Lewis Marffy, A.L., Zhang, Y. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-74098-6 · PubMed

Other PDB entries of the same protein (UniProt P27951 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S0R 2.5 Å, Crystal Structure of a Complement Factor H-binding Fragment within the B75KN Region of…
6V3P 3.25 Å, The BIgI domain of beta protein from S. agalactiae bound to CEACAM1
5WAH Solution NMR structure of siglec-5 binding domain from streptococcal beta protein

Browse structure collections

About this viewer

MolViewer shows 9MN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.