6V3P: PDB entry 6V3P

The BIgI domain of beta protein from S. agalactiae bound to CEACAM1. Determined by X-ray diffraction at 3.25 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 3.25 Å
Organisms: Homo sapiens, Streptococcus agalactiae
Chains: 4
Atoms: 3,349
Mol. weight: 53.24 kDa
Released: 2 Dec 2020

Explore 6V3P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V3P contains 6 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
β-strand	10-11	2	2
β-strand	17	1	3
β-strand	18-19	2	1
β-strand	28-34	7	4
β-strand	36	1	4
α-helix	41-43	3
β-strand	44-49	6	4
β-strand	54-57	4	4
β-strand	75	1	3
α-helix	80-82	3
β-strand	84-92	9	4
β-strand	98-104	7	4
β-strand	105-106	2	2

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	5
β-strand	10-11	2	6
β-strand	17-19	3	5
β-strand	28-34	7	7
β-strand	36	1	7
α-helix	41-43	3
β-strand	44-49	6	7
β-strand	54-57	4	7
β-strand	66-67	2	5
β-strand	73-75	3	5
α-helix	80-82	3
β-strand	84-92	9	7
β-strand	98-104	7	7
β-strand	105-106	2	6

Chain C: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	8
β-strand	16	1	9
β-strand	19-20	2	10
β-strand	25-32	8	8
β-strand	38-40	3	9
α-helix	42-48	7
β-strand	56-58	3	8
β-strand	67-74	8	8
β-strand	83-90	8	9
β-strand	95-103	9	9
β-strand	105-106	2	10

Chain D: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	11
β-strand	16	1	9
β-strand	19-20	2	12
β-strand	25-32	8	11
β-strand	38-40	3	9
α-helix	42-48	7
β-strand	57-59	3	11
β-strand	67-74	8	11
β-strand	83-90	8	9
β-strand	96-103	8	9
β-strand	105-106	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Carcinoembryonic antigen-related cell adhesion molecule 1	A, B	protein	109	Homo sapiens	P13688 (AlphaFold model)
IgA FC receptor	C, D	protein	126	Streptococcus agalactiae	P27951 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6V3P_1 Carcinoembryonic antigen-related cell adhesion molecule 1 (chains A, B)
MAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPG
PANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY

Sequence of entity 2 (C, D), FASTA

>6V3P_2 IgA FC receptor (chains C, D)
ANENNQQKIELTVSPENITVYEGEDVKFTVTAKSDSKTTLDFSDLLTKYNPSVSDRISTN
YKTNTDNHKIAEITIKNLKLNESQTVTLKAKDDSGNVVEKTFTITVQKKEEKQLPSTGGS
HHHHHH

Primary citation

Bacterial protein domains with a novel Ig-like fold target human CEACAM receptors. van Sorge, N.M., Bonsor, D.A., Deng, L. et al. EMBO J (2021) 40:e106103-e106103. DOI 10.15252/embj.2020106103 · PubMed

Other PDB entries of the same protein (UniProt P13688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MU8 1.7 Å, Structure of the minimally glycosylated human CEACAM1 N-terminal domain
6XO1 1.76 Å, Crystal structure of N97A mutant of human CEACAM1
23VF 1.79 Å, Crystal structure of CEACAM1 in complex with MG1124 antibody
6XNO 1.9 Å, Crystal structure of E99A mutant of human CEACAM1
6XNW 1.9 Å, Crystal structure of V39A mutant of human CEACAM1
4QXW 2.04 Å, Crystal structure of the human CEACAM1 membrane distal amino terminal (N)-domain
9U94 2.11 Å, Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1
2GK2 2.2 Å, Crystal structure of the N terminal domain of human CEACAM1
7RPP 2.2 Å, Crystal structure of human CEACAM1 with GFCC' and ABED face
4WHD 2.5 Å, Human CEACAM1 N-domain homodimer
6GBH 2.59 Å, Helicobacter pylori adhesin HopQ type II bound to the N-terminal domain of human CEACAM1
6AW2 2.68 Å, Crystal structure of the HopQ-CEACAM1 complex

Browse structure collections

About this viewer

MolViewer shows 6V3P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.