9MNS: RM1-36 Fab heavy chain

Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36. Determined by X-ray diffraction at 2.89 Å resolution. Released 14 Jan 2026.

Method: X-ray diffraction
Resolution: 2.89 Å
Organisms: Macaca mulatta, Recombinant Hepatitis C virus HK6a/JFH-1
Chains: 6
Atoms: 9,140
Mol. weight: 146.4 kDa
Ligands: NAG
Released: 14 Jan 2026

Explore 9MNS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MNS contains 44 α-helices and 112 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	426-427	2	26
α-helix	439-442	4
β-strand	496-498	3	27
α-helix	499-501	3
β-strand	502	1	28
β-strand	503-504	2	26
β-strand	506-509	4	29
β-strand	513-516	4	29
β-strand	519	1	27
α-helix	524-526	3
β-strand	536-538	3	27
α-helix	539-542	4
β-strand	551-555	5	29
β-strand	556	1	28
β-strand	561-565	5	29
β-strand	608-609	2	30
α-helix	614-617	4
α-helix	619-623	5
α-helix	624	1
β-strand	625-632	8	30
β-strand	637-644	8	30

Chain E: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	422-424	3
β-strand	426-427	2	21
α-helix	439-442	4
β-strand	496-498	3	22
α-helix	499-501	3
β-strand	502	1	23
β-strand	503-504	2	21
β-strand	506-509	4	24
β-strand	513-516	4	24
β-strand	519	1	22
α-helix	524-526	3
β-strand	536-538	3	22
α-helix	539-542	4
β-strand	551-555	5	24
β-strand	556	1	23
β-strand	561-565	5	24
β-strand	608-609	2	25
α-helix	614-617	4
α-helix	619-623	5
α-helix	624	1
β-strand	625-632	8	25
β-strand	637-644	8	25

Chain h: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	16
β-strand	10-12	3	17
β-strand	17-25	9	16
β-strand	32-39	8	17
β-strand	45-52	8	17
β-strand	56-59	4	17
α-helix	61-63	3
β-strand	67-72	6	16
β-strand	77-82a	7	16
α-helix	84-86	3
β-strand	88-96	9	17
β-strand	102	1	17
β-strand	107-111	5	17
β-strand	117	1	18
α-helix	118-119	2
β-strand	120-124	5	19
β-strand	135-145	11	19
β-strand	146	1	18
β-strand	151-154	4	20
α-helix	155-157	3
β-strand	163-165	3	19
α-helix	166-168	3
β-strand	169-170	2	19
β-strand	176-185	10	19
α-helix	186-188	3
β-strand	194-200	7	20
α-helix	201-203	3
β-strand	205-211	7	20

Chain H: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	17-25	9	1
β-strand	32-39	8	2
β-strand	45-52	8	2
β-strand	56-59	4	2
α-helix	61-63	3
β-strand	67-72	6	1
β-strand	77-82a	7	1
α-helix	84-86	3
β-strand	88-96	9	2
α-helix	99-100a	3
β-strand	102	1	2
β-strand	107-111	5	2
β-strand	117	1	3
α-helix	118-119	2
β-strand	120-124	5	4
β-strand	135-145	11	4
β-strand	146	1	3
β-strand	151-154	4	5
α-helix	155-157	3
β-strand	163-165	3	4
α-helix	166-168	3
β-strand	169-170	2	4
β-strand	176-185	10	4
α-helix	186-188	3
β-strand	195-200	6	5
α-helix	201-203	3
β-strand	205-210	6	5

Chain l: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-12	3	12
β-strand	19-25	7	11
β-strand	33-38	6	12
β-strand	45-49	5	12
β-strand	53-54	2	12
α-helix	55	1
β-strand	62-67	6	11
β-strand	70-75	6	11
α-helix	80-82	3
β-strand	85-90	6	12
α-helix	96	1
β-strand	97	1	12
β-strand	102-105	4	12
β-strand	111	1	13
β-strand	114-118	5	14
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	14
β-strand	140	1	13
β-strand	145-150	6	15
β-strand	154	1	15
β-strand	159-163	5	14
α-helix	164-167	4
β-strand	173-182	10	14
α-helix	183-187	5
β-strand	191-198	8	15
β-strand	201-208	8	15

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-12	3	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	85-90	6	7
α-helix	96	1
β-strand	97	1	7
β-strand	102-105	4	7
β-strand	111	1	8
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	154	1	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-187	5
β-strand	191-197	7	10
β-strand	202-208	7	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RM1-36 Fab heavy chain	H, h	protein	222	Macaca mulatta
RM1-36 Fab light chain	L, l	protein	211	Macaca mulatta
Envelope glycoprotein E2	B, E	protein	231	Recombinant Hepatitis C virus HK6a/JFH-1	B9V0E2

Sequence of entity 1 (H, h), FASTA

>9MNS_1 RM1-36 Fab heavy chain (chains H, h)
VQLVQSGAEVKKPGASVKLSCKASGFTFSIYAICWVRQAPGQGLEWMGEIIPRVGLTTYA
QKFQGRVTITADTSTTTVYMELSSLRSEDTAVYYCVRGPRYSEYSYRASWFDVWGPGVLV
TVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

Sequence of entity 2 (L, l), FASTA

>9MNS_2 RM1-36 Fab light chain (chains L, l)
DIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDPYSFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTQGTTSVTKSFNRGE

Sequence of entity 3 (B, E), FASTA

>9MNS_3 Envelope glycoprotein E2 (chains B, E)
HINRTALNCNDSLQTGFITSLFYAKNVDSSGCPERMAACKPLADFRQGWGQITYKVNISG
PSDDRPYCWHYAPRPCDVVSARTVCGPVYCFTPSPVVVGTTDKLGIPTYNWGENETDVFM
LESLRPPTGGWFGCTWMNSTGFTKTCGAPPCQIVPGDYNSSANELLCPTDCFRKHPEATP
TDGGSGPWITPRCLVDYPYRLWHYPCTVNFTLHKVRMFVGGIEHRFDAACN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Structural and genetic signatures of two classes of HCV E2 neutralizing face antibodies from non-human primates immunized with a recombinant E1E2. Nguyen, Y.T.K., Chen, F., Giang, E. et al. NPJ Vaccines (2026) 11. DOI 10.1038/s41541-026-01449-1 · PubMed

Other PDB entries of the same protein (UniProt B9V0E2), best resolution first:

6UYF 2.06 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
6WO4 2.35 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6WO3 2.38 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKC 2.6 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
7JTG 2.6 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKB 2.8 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKD 3.25 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
7JTF 3.35 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6UYG 3.38 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2c3 core from genotype 6a bound to…

Browse structure collections

About this viewer

MolViewer shows 9MNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.