9MQJ: Mu-type opioid receptor

Locally-refined Inactive Mu-Opioid Receptor with Nb6M, NabFab, and isoquinuclidine compound #020_E1. Determined by electron microscopy at 3.23 Å resolution. Released 12 Feb 2025.

Method: Electron microscopy
Resolution: 3.23 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,134
Mol. weight: 46.48 kDa
Ligands: A1BNM
Released: 12 Feb 2025

Explore 9MQJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MQJ contains 13 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	68-97	30
α-helix	104-121	18
α-helix	123-128	6
α-helix	129-131	3
α-helix	139-172	34
α-helix	174-180	7
α-helix	183-207	25
β-strand	208-211	4	1
β-strand	218-221	4	1
α-helix	230-238	9
α-helix	239-244	6
α-helix	245-262	18
α-helix	271-307	37
α-helix	314-341	28
α-helix	343-351	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor	A	protein	411	Homo sapiens	P35372 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9MQJ_1 Mu-type opioid receptor (chains A)
DYKDDDDASIDMDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNR
TDLGGRDSLCPPTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYI
FNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYI
AVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWY
WENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRLLSGSREKDRNLRRITRMVLVVVA
VFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCF
REFCIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP

Ligands and cofactors

ID	Name	Formula	Copies
A1BNM	methyl (1S,3R,4S,6S,8M)-2-[(1-ethyl-1H-pyrazol-4-yl)methyl]-8-(3-hydroxyphenyl)…	C23 H29 N3 O3	1

Primary citation

Docking 14 million virtual isoquinuclidines against the mu and kappa opioid receptors reveals dual antagonists-inverse agonists with reduced withdrawal effects. Vigneron, S.F., Ohno, S., Braz, J. et al. bioRxiv (2025). DOI 10.1101/2025.01.09.632033 · PubMed

Other PDB entries of the same protein (UniProt P35372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Y72 2.65 Å, positive allosteric modulator(BMS986122)-bound mu-opioid receptor-Gi complex
9PY4 2.78 Å, Primed-state loperamide-mu opioid receptor-Gi GDPbS complex (rebound)
8EFO 2.8 Å, PZM21-bound mu-opioid receptor-Gi complex
9WST 2.8 Å, Cryo-EM structure of DAMGO-muOR-Gz-scFv16 complex
8Y73 2.84 Å, positive allosteric modulator(MPAM-15)-bound mu-opioid receptor-Gi complex
9PA2 2.86 Å, PCP bound mu-opioid receptor in complex with Gi1
9PA5 2.92 Å, (S)-ketamine bound mu-opioid receptor in complex with Gi1
23SO 2.95 Å, Cryo-EM structure of the cebranopadol-mu opioid receptor-Gi complex
9VJT 2.97 Å, Cryo-EM structure of MST-OR complex
8K9K 2.98 Å, Full agonist-bound mu-type opioid receptor-G protein complex
10TM 3.0 Å, Cryo-EM structure of MOR bound with DAMGO
9PUD 3.0 Å, Cryo-EM structure of MOR-Gi1 complex protein bound with DAMGO

Browse structure collections

About this viewer

MolViewer shows 9MQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.