9MT2: Machupo virus glycoprotein complex

Structure of the Machupo virus glycoprotein complex. Determined by electron microscopy at 2.9 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Mammarenavirus machupoense
Chains: 9
Atoms: 11,871
Mol. weight: 178.83 kDa
Ligands: NAG, ZN
Released: 16 Jul 2025

Explore 9MT2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MT2 contains 60 α-helices and 68 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-9	7
α-helix	11-14	4
α-helix	18-41	24
α-helix	43-51	9

Chain B: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	63	1	1
β-strand	68-74	7	1
β-strand	75	1	2
α-helix	78-83	6
β-strand	90-93	4	3
β-strand	98-103	6	3
β-strand	106-113	8	3
β-strand	124	1	4
α-helix	131-134	4
α-helix	143-151	9
β-strand	163	1	3
β-strand	164	1	4
β-strand	175-177	3	3
α-helix	188-199	12
β-strand	214-219	6	3
α-helix	223-228	6
α-helix	233-236	4
β-strand	240	1	3
α-helix	241-248	8

Chain C: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	281-283	3	5
α-helix	285-287	3
β-strand	288	1	2
β-strand	294-296	3	5
α-helix	298-302	5
α-helix	303-305	3
α-helix	311-328	18
α-helix	339-347	9
α-helix	350-361	12
β-strand	366	1	6
β-strand	371-377	7	1
β-strand	383	1	1
α-helix	384-386	3
β-strand	387-388	2	1
β-strand	391-392	2	6
β-strand	395-396	2	6
α-helix	397-398	2
α-helix	403-428	26
α-helix	431-453	23
β-strand	458-461	4	7
β-strand	490-493	4	7

Chain E: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	62-63	2	8
β-strand	68-74	7	8
β-strand	75	1	9
α-helix	78-83	6
β-strand	90-93	4	10
β-strand	98-103	6	10
β-strand	106-113	8	10
β-strand	125-126	2	10
α-helix	143-151	9
β-strand	162-163	2	10
β-strand	175-178	4	10
α-helix	188-199	12
β-strand	214-219	6	10
α-helix	223-228	6
α-helix	233-236	4
α-helix	241-248	8

Chain F: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	281-283	3	11
α-helix	285-287	3
β-strand	288	1	9
β-strand	294-296	3	11
α-helix	298-302	5
α-helix	311-324	14
α-helix	325-329	5
α-helix	339-344	6
α-helix	350-361	12
β-strand	366	1	12
β-strand	371-377	7	8
β-strand	383	1	8
α-helix	384-386	3
β-strand	387-388	2	8
β-strand	391-392	2	12
β-strand	395-396	2	12
α-helix	397-398	2
α-helix	403-428	26
α-helix	431-453	23
β-strand	458-461	4	13
β-strand	490-493	4	13

Chain G: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	11-14	4
α-helix	18-41	24
α-helix	43-51	9

Chain H: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	62-63	2	14
β-strand	68-74	7	14
β-strand	75	1	15
α-helix	78-83	6
β-strand	90-93	4	16
β-strand	98-103	6	16
β-strand	106-113	8	16
β-strand	125-126	2	16
α-helix	131-134	4
α-helix	143-151	9
β-strand	162-163	2	16
β-strand	175-178	4	16
α-helix	188-199	12
β-strand	214-219	6	16
β-strand	220	1	17
β-strand	222	1	17
α-helix	223-228	6
β-strand	240	1	16
α-helix	241-247	7

Chain I: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	281-283	3	18
α-helix	285-287	3
β-strand	288	1	15
β-strand	294-296	3	18
α-helix	298-302	5
α-helix	311-324	14
α-helix	325-329	5
α-helix	339-346	8
α-helix	350-361	12
β-strand	366	1	19
β-strand	371-377	7	14
β-strand	383	1	14
α-helix	384-386	3
β-strand	387-388	2	14
β-strand	391-392	2	19
β-strand	395-396	2	19
α-helix	403-428	26
α-helix	431-453	23
β-strand	458-461	4	20
β-strand	490-493	4	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-glycoprotein polyprotein GP complex	A, D, G	protein	58	Mammarenavirus machupoense	Q6IUF7
Pre-glycoprotein polyprotein GP complex	B, E, H	protein	204	Mammarenavirus machupoense	Q8AZ57 (AlphaFold model)
Pre-glycoprotein polyprotein GP complex	C, F, I	protein	234	Mammarenavirus machupoense	Q6IUF7

Sequence of entity 1 (A, D, G), FASTA

>9MT2_1 Pre-glycoprotein polyprotein GP complex (chains A, D, G)
MGQLISFFQEIPVFLQEALNIALVAVSLIAVIAGIINLYKSGLFQFIFFLLLAGRSCS

Sequence of entity 2 (B, E, H), FASTA

>9MT2_2 Pre-glycoprotein polyprotein GP complex (chains B, E, H)
DGTFKIGLHTEFQSVTLTMQRLLANHSNELPSLCMLNNSFYYMRGGVNTFLIRVSDISVL
MKEYDVSIYEPEDLGNCLNKSDSSWAIHWFSNALGHDWLMDPPMLCRNKTKKEGSNIQFN
ISKADDARVYGKKIRNGMRHLFRGFHDPCEEGKVCYLTINQCGDPSSFDYCGVNHLSKCQ
FDHVNTLHFLVRSKTHLNFERSLK

Sequence of entity 3 (C, F, I), FASTA

>9MT2_3 Pre-glycoprotein polyprotein GP complex (chains C, F, I)
AFFSWSLTDSSGKDMPGGYCLEEWMLIAAKMKCFGNTAVAKCNQNHDSEFCDMLRLFDYN
KNAIKTLNDEAKKEINLLSQAVNALISDNLLMKNKIKELMSIPYCNYTKFWYVNHTLTGQ
HTLPRCWLIRNGSYLNTSEFRNDWILESDHLISEMLSKEYAERQGKTPITLVDICFWSTI
FFTASLFLHLVGIPTHRHLKGEACPLPHKLDSFGGCRCGKYPRLKKPTIWHKRH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	12
ZN	Zinc ion	Zn	6

Primary citation

Molecular organization of the New World arenavirus spike glycoprotein complex. Mann, C.J., Yang, P., Olal, D. et al. Nat Microbiol (2025) 10:2207-2220. DOI 10.1038/s41564-025-02085-6 · PubMed

Other PDB entries of the same protein (UniProt Q6IUF7), best resolution first:

9GHI 2.41 Å, Machupo virus GP1-GP2 heterodimer in complex with Fab of MAC1

Browse structure collections

About this viewer

MolViewer shows 9MT2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.