9MU4: Histone H2A
Structure of a native Drosophila melanogaster octameric nucleosome. Determined by electron microscopy at 3.29 Å resolution. Released 19 Feb 2025.
- Method
- Electron microscopy
- Resolution
- 3.29 Å
- Organism
- Drosophila melanogaster
- Chains
- 10
- Atoms
- 12,794
- Mol. weight
- 188.36 kDa
- Released
- 19 Feb 2025
Explore 9MU4 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9MU4 contains 36 α-helices and 20 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains a and e: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 46-55 | 10 | |
| α-helix | 65-79 | 15 | |
| β-strand | 84-85 | 2 | 7 |
| α-helix | 87-114 | 28 | |
| β-strand | 119-120 | 2 | 8 |
| α-helix | 122-132 | 11 | |
Chain b: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-29 | 3 | |
| α-helix | 32-42 | 11 | |
| β-strand | 46-47 | 2 | 8 |
| α-helix | 51-76 | 26 | |
| β-strand | 81-82 | 2 | 7 |
| α-helix | 84-93 | 10 | |
| β-strand | 97-99 | 3 | 6 |
Chain c: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 1 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 2 |
| α-helix | 80-89 | 10 | |
| α-helix | 92-96 | 5 | |
| β-strand | 100-102 | 3 | 3 |
| α-helix | 117-118 | 2 | |
Chain d: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-46 | 11 | |
| β-strand | 51-52 | 2 | 2 |
| α-helix | 54-81 | 28 | |
| β-strand | 86-87 | 2 | 1 |
| α-helix | 89-99 | 11 | |
| α-helix | 103-121 | 19 | |
Chain f: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-29 | 4 | |
| α-helix | 32-42 | 11 | |
| β-strand | 46-47 | 2 | 10 |
| α-helix | 51-76 | 26 | |
| β-strand | 81-82 | 2 | 9 |
| α-helix | 84-93 | 10 | |
| β-strand | 97-99 | 3 | 3 |
Chain g: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-20 | 4 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 5 |
| α-helix | 80-89 | 10 | |
| α-helix | 92-96 | 5 | |
| β-strand | 100-102 | 3 | 6 |
| α-helix | 117-118 | 2 | |
Chain h: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-46 | 11 | |
| β-strand | 51-52 | 2 | 5 |
| α-helix | 54-81 | 28 | |
| β-strand | 86-87 | 2 | 4 |
| α-helix | 89-99 | 11 | |
| α-helix | 103-122 | 20 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H2A | c, g | protein | 106 | Drosophila melanogaster | P84051 (AlphaFold model) |
| Histone H2B | d, h | protein | 97 | Drosophila melanogaster | P02283 (AlphaFold model) |
| Histone H3 | a, e | protein | 100 | Drosophila melanogaster | P02299 (AlphaFold model) |
| Histone H4 | b, f | protein | 82 | Drosophila melanogaster | P84040 (AlphaFold model) |
| DNA (164-mer) | T | DNA | 164 | Drosophila melanogaster | |
| DNA (164-mer) | N | DNA | 164 | Drosophila melanogaster | |
Sequence of entity 1 (c, g), FASTA
>9MU4_1 Histone H2A (chains c, g)
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDN
KKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK
Sequence of entity 2 (d, h), FASTA
>9MU4_2 Histone H2B (chains d, h)
KKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRST
ITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Sequence of entity 3 (a, e), FASTA
>9MU4_3 Histone H3 (chains a, e)
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA
SEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sequence of entity 4 (b, f), FASTA
>9MU4_4 Histone H4 (chains b, f)
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
Sequence of entity 5 (T), FASTA
>9MU4_5 DNA (164-MER) (chains T)
TATATATATATATATATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCT
CTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTA
CTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGATATAT
Sequence of entity 6 (N), FASTA
>9MU4_6 DNA (164-MER) (chains N)
ATATATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGT
TAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAA
TTGAGCGGCCTCGGCACCGGGATTCTGATATATATATATATATA
Primary citation
Structural Characterization of Native RNA Polymerase II Transcription Complexes and Nucleosomes in Drosophila melanogaster. Venette-Smith, N.L., Vishwakarma, R.K., Venkatakrishnan, V. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-75963-0 · PubMed
Other PDB entries of the same protein (UniProt P84051 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9ZQB 2.1 Å, Nucleosome with an SSB at SHL -2.8 in complex with human PARP2 and HPF1, Class 1
- 2NQB 2.3 Å, Drosophila Nucleosome Structure
- 9ZQC 2.37 Å, Nucleosome with an SSB at SHL -2.8 in complex with human PARP2 and HPF1, Class 2
- 2PYO 2.43 Å, Drosophila nucleosome core
- 8UX1 2.5 Å, Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
- 8PP7 2.91 Å, human RYBP-PRC1 bound to mononucleosome
- 6DZT 2.99 Å, Cryo-EM structure of nucleosome in complex with a single chain antibody fragment
- 8PP6 3.18 Å, human RYBP-PRC1 bound to H2AK118ub1 nucleosome
- 9ZQA 3.28 Å, Nucleosome with an SSB at SHL -2.8 in complex with the WGR domain of human PARP2, Class 2
- 9ZQ9 3.3 Å, Nucleosome with an SSB at SHL -2.8 in complex with the WGR domain of human PARP2, Class 1
- 4X23 3.5 Å, Crystal structure of cenp-C in complex with the nucleosome core particle
- 4QLC 3.5 Å, Crystal structure of chromatosome at 3.5 angstrom resolution
Browse structure collections
About this viewer
MolViewer shows 9MU4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.