9MZG: GCGR-Gs complex with glucagon

Cryo-EM structure of GCGR-Gs complex with glucagon. Determined by electron microscopy at 3.0 Å resolution. Released 22 Apr 2026.

Method: Electron microscopy
Resolution: 3.0 Å
Organisms: synthetic construct, Homo sapiens, Lama glama
Chains: 6
Atoms: 9,339
Mol. weight: 181.41 kDa
Released: 22 Apr 2026

Explore 9MZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MZG contains 38 α-helices and 55 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	10-39	30
β-strand	41-48	8	5
β-strand	209-214	6	5
β-strand	217-223	7	5
β-strand	243-249	7	5
α-helix	265-278	14
β-strand	286-292	7	5
α-helix	294-302	9
α-helix	308-311	4
α-helix	326-327	2
α-helix	332-351	20
β-strand	359-363	5	5
α-helix	371-390	20

Chain B: 4 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	3-24	22
α-helix	30-33	4
α-helix	38-39	2
β-strand	47-51	5	6
β-strand	58-63	6	7
β-strand	69-74	6	7
β-strand	78-83	6	7
β-strand	89-94	6	7
β-strand	100-105	6	8
β-strand	111-116	6	8
β-strand	121-125	5	8
β-strand	134-139	6	8
β-strand	146-151	6	9
β-strand	156-161	6	9
β-strand	165-170	6	9
β-strand	176-181	6	9
β-strand	187-192	6	10
β-strand	198-203	6	10
β-strand	208-212	5	10
β-strand	218-222	5	10
β-strand	229-234	6	11
β-strand	240-245	6	11
β-strand	250-254	5	11
β-strand	260-264	5	11
α-helix	272	1
β-strand	273-278	6	12
β-strand	284-289	6	12
β-strand	294-298	5	12
β-strand	304-308	5	12
β-strand	315	1	13
β-strand	319-320	2	6
β-strand	327-330	4	6
β-strand	331	1	13
β-strand	336-339	4	6

Chain G: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	8-22	15
α-helix	30-43	14
α-helix	45-47	3
α-helix	53-55	3

Chain N: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	14
β-strand	10-12	3	15
β-strand	17-25	9	14
β-strand	36-39	4	15
β-strand	45-50	6	15
β-strand	59-60	2	15
β-strand	68-73	6	14
β-strand	78-84	7	14
α-helix	88-90	3
β-strand	92-95	4	15
β-strand	122-126	5	15

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-28	25

Chain R: 21 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	29-49	21
α-helix	51-53	3
β-strand	58	1	1
β-strand	71	1	1
β-strand	77-80	4	2
α-helix	81-82	2
β-strand	95-98	4	2
β-strand	100	1	3
β-strand	106	1	3
α-helix	107	1
β-strand	108	1	4
β-strand	114	1	4
β-strand	117	1	2
α-helix	123-124	2
α-helix	125-165	41
α-helix	167-169	3
α-helix	172-202	31
α-helix	205-206	2
α-helix	209-215	7
α-helix	222-253	32
α-helix	264-271	8
α-helix	273-288	16
α-helix	301-304	4
α-helix	309-335	27
α-helix	345-358	14
α-helix	360-362	3
α-helix	363-366	4
α-helix	376-397	22
α-helix	398-402	5
α-helix	405-418	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucagon	P	protein	29	synthetic construct	P01273 (AlphaFold model)
Glucagon receptor	R	protein	475	Homo sapiens	P47871 (AlphaFold model)
Guanine nucleotide-binding protein G(s) subunit alpha isoforms short	A	protein	394	Homo sapiens	P63092 (AlphaFold model)
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	B	protein	530	Homo sapiens
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2	G	protein	58	Homo sapiens	P59768 (AlphaFold model)
Nb35	N	protein	128	Lama glama

Sequence of entity 1 (P), FASTA

>9MZG_1 Glucagon (chains P)
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT

Sequence of entity 2 (R), FASTA

>9MZG_2 Glucagon receptor (chains R)
MKTIIALSYIFCLVFAAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWP
DTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIE
VQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKAS
SVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYL
HNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRF
PVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVT
DEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERN
TSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPFDYKDDDD

Sequence of entity 3 (A), FASTA

>9MZG_3 Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (chains A)
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKNTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGAQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQAALKLFDSIWNNKWLRDTSVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCSVDTENIRRVFNDCRDIIQRMHLRQYELL

Sequence of entity 4 (B), FASTA

>9MZG_4 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (chains B)
MHHHHHHGSSGSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT
LRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGN
YVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWD
IETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDIN
AICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYD
DFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWNSGDTTCALWD
IETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDIN
AICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYD
DFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Sequence of entity 5 (G), FASTA

>9MZG_5 Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (chains G)
NTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFR

Sequence of entity 6 (N), FASTA

>9MZG_6 Nb35 (chains N)
QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISY
TGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQ
GTQVTVSS

Primary citation

Cryo-EM structure of GCGR-Gs complex with glucagon. Zhang, X., Belousoff, M.J., Wootten, D. et al. To be published.

Other PDB entries of the same protein (UniProt P01273 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GJI 1.81 Å, De novo design of high-affinity protein binders to bioactive helical peptides
9MXU 2.5 Å, cryo-EM structure of GLP-1R-Gs complex with glucagon

Browse structure collections

About this viewer

MolViewer shows 9MZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.