9MZY: Human RIPK1 with Compound 22

Crystal structure of human RIPK1 with Compound 22. Determined by X-ray diffraction at 2.32 Å resolution. Released 28 May 2025.

Method: X-ray diffraction
Resolution: 2.32 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,486
Mol. weight: 66.51 kDa
Ligands: A1BU6, GLY
Released: 28 May 2025

Explore 9MZY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MZY contains 37 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	9-10	2
β-strand	11	1	1
β-strand	17-18	2	1
β-strand	31-36	6	1
β-strand	40-49	10	1
α-helix	57-68	12
β-strand	75	1	2
α-helix	76-77	2
β-strand	78-84	7	1
β-strand	87-92	6	1
β-strand	98-99	2	2
α-helix	100-104	5
α-helix	109-111	3
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	2
β-strand	152-154	3	2
α-helix	163-169	7
α-helix	190-192	3
α-helix	204-205	2
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	276-277	2
α-helix	278-288	11
α-helix	289-293	5

Chain B: 19 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	9-10	2
β-strand	11-12	2	3
α-helix	14-16	3
β-strand	17-22	6	3
β-strand	31-36	6	3
β-strand	40-49	10	3
α-helix	57-68	12
β-strand	75	1	4
α-helix	76-77	2
β-strand	78-84	7	3
β-strand	87-92	6	3
β-strand	98-99	2	4
α-helix	100-104	5
α-helix	109-111	3
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	4
β-strand	152-154	3	4
α-helix	163-169	7
α-helix	195-197	3
α-helix	204-205	2
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	276-277	2
α-helix	278-288	11
α-helix	289-293	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-interacting serine/threonine-protein kinase 1	A, B	protein	287	Homo sapiens	Q13546 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9MZY_1 Receptor-interacting serine/threonine-protein kinase 1 (chains A, B)
NVIKMKSSDFLESAELDSGGFGKVSLAFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMM
NRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMA
YLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNG
GTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAIAEQQLIMAIKSGNRP
DVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLE

Ligands and cofactors

ID	Name	Formula	Copies
A1BU6	1-[(2S,5S)-2,3-dihydro-2,5-methano-1,4-benzoxazepin-4(5H)-yl]-3,3-difluoro-2,2-…	C15 H17 F2 N O2	2
GLY	Glycine	C2 H5 N O2	1

Water and common crystallization additives (IOD, CL) are not listed.

Primary citation

The Discovery of Bridged Benzoazepine Amides as Selective Allosteric Modulators of RIPK1. Chen, J.L., Methot, J.L., Mitcheltree, M.J. et al. ACS Med Chem Lett (2025) 16:811-818. DOI 10.1021/acsmedchemlett.5c00063 · PubMed

Other PDB entries of the same protein (UniProt Q13546 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZMZ 1.4 Å, Amyloid core of RIP1
6AC5 1.45 Å, Crystal structure of RIPK1 death domain GlcNAcylated by EPEC effector NleB
4ITJ 1.8 Å, Crystal structure of RIP1 kinase in complex with necrostatin-4
6NW2 2.0 Å, Structure of human RIPK1 kinase domain in complex with compound 11
7FD0 2.0 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
24IB 2.05 Å, Crystal structure of human RIPK1 kinase domain in complex with compound HR10
9Q31 2.05 Å, RIP1 kinase domain in complex with GDC-8264
6NYH 2.1 Å, Structure of human RIPK1 kinase domain in complex with GNE684
9GTY 2.15 Å, RIPK1 in complex with AZ"320
7FCZ 2.21 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
5HX6 2.23 Å, Crystal structure of RIP1 kinase with a benzo[b][1,4]oxazepin-4-one
4ITH 2.25 Å, Crystal structure of RIP1 kinase in complex with necrostatin-1 analog

Browse structure collections

About this viewer

MolViewer shows 9MZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.