9N44: Human KRAS-G12C covalent

Crystal structure of human KRAS-G12C covalent bound to Olomorasib. Determined by X-ray diffraction at 1.11 Å resolution. Released 10 Dec 2025.

Method: X-ray diffraction
Resolution: 1.11 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,499
Mol. weight: 20.48 kDa
Ligands: GDP, A1BV7, MG
Released: 10 Dec 2025

Explore 9N44 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9N44 contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	66-73	8
β-strand	77-83	7	1
α-helix	87-91	5
α-helix	93-104	12
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
α-helix	152-167	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2B of GTPase KRas	A	protein	169	Homo sapiens	P01116 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9N44_1 Isoform 2B of GTPase KRas (chains A)
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAG
QEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
A1BV7	Olomorasib Bound Form	C25 H21 Cl F2 N4 O3 S	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Crystal structure of human KRAS-G12C covalent bound to Olomorasib. Wang, J., Hendle, J., Saflor, M.D. et al. To be published.

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
6P0Z 1.01 Å, Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865

Browse structure collections

About this viewer

MolViewer shows 9N44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.