Crystal structure of PAK1 bound to compound C1. Determined by X-ray diffraction at 1.85 Å resolution. Released 25 Jun 2025.
Explore 9N48 in 3D Show helices and sheets RCSB PDB PDBe
9N48 contains 42 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 250-259 | 10 | |
| β-strand | 262-263 | 2 | 1 |
| α-helix | 266-269 | 4 | |
| β-strand | 270-279 | 10 | 1 |
| β-strand | 282-289 | 8 | 1 |
| β-strand | 295-302 | 8 | 1 |
| α-helix | 303-305 | 3 | |
| α-helix | 309-321 | 13 | |
| β-strand | 327 | 1 | 2 |
| β-strand | 330-336 | 7 | 1 |
| β-strand | 339-345 | 7 | 1 |
| β-strand | 351 | 1 | 2 |
| α-helix | 352-358 | 7 | |
| α-helix | 360-362 | 3 | |
| α-helix | 363-382 | 20 | |
| β-strand | 385-386 | 2 | 3 |
| α-helix | 392-394 | 3 | |
| β-strand | 395-397 | 3 | 2 |
| β-strand | 403-405 | 3 | 2 |
| α-helix | 408-410 | 3 | |
| β-strand | 412-413 | 2 | 3 |
| β-strand | 415 | 1 | 4 |
| β-strand | 418 | 1 | 4 |
| β-strand | 421 | 1 | 5 |
| α-helix | 428-430 | 3 | |
| α-helix | 433-436 | 4 | |
| β-strand | 441 | 1 | 5 |
| α-helix | 444-459 | 16 | |
| α-helix | 469-479 | 11 | |
| α-helix | 482-484 | 3 | |
| α-helix | 487-489 | 3 | |
| α-helix | 492-501 | 10 | |
| α-helix | 510-511 | 2 | |
| α-helix | 512-515 | 4 | |
| α-helix | 519-523 | 5 | |
| α-helix | 524-526 | 3 | |
| α-helix | 527-530 | 4 | |
| α-helix | 531-543 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 256-260 | 5 | |
| α-helix | 266-269 | 4 | |
| β-strand | 270-279 | 10 | 6 |
| β-strand | 282-289 | 8 | 6 |
| β-strand | 295-302 | 8 | 6 |
| α-helix | 309-321 | 13 | |
| β-strand | 327 | 1 | 7 |
| α-helix | 328-329 | 2 | |
| β-strand | 330-335 | 6 | 6 |
| β-strand | 339-345 | 7 | 6 |
| β-strand | 351 | 1 | 7 |
| α-helix | 352-358 | 7 | |
| α-helix | 363-382 | 20 | |
| α-helix | 392-394 | 3 | |
| β-strand | 395-397 | 3 | 7 |
| β-strand | 403-405 | 3 | 7 |
| α-helix | 423-424 | 2 | |
| α-helix | 433-436 | 4 | |
| α-helix | 444-459 | 16 | |
| α-helix | 469-479 | 11 | |
| α-helix | 482-484 | 3 | |
| α-helix | 487-489 | 3 | |
| α-helix | 492-501 | 10 | |
| α-helix | 510-511 | 2 | |
| α-helix | 512-515 | 4 | |
| α-helix | 519-523 | 5 | |
| α-helix | 524-526 | 3 | |
| α-helix | 527-530 | 4 | |
| α-helix | 531-541 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutathione S-transferase class-mu 26 kDa isozyme,Serine/threonine-protein kinase PAK 1 | A, B | protein | 537 | Homo sapiens | P08515 (AlphaFold model), Q13153 (AlphaFold model) |
>9N48_1 Glutathione S-transferase class-mu 26 kDa isozyme,Serine/threonine-protein kinase PAK 1 (chains A, B) MHHHHHHHHGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLE FPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAY SKDFETLKVDFLSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLD AFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGENLYFQGSDE EILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKEL IINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCR ECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWM APEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLS AIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNHGNS
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1BV1 | (6M)-8-[2-(2-aminoethoxy)ethyl]-6-[2-chloro-3-fluoro-4-(2-oxopyrrolidin-1-yl)ph… | C23 H26 Cl F N6 O3 | 2 |
Integrating Hydrogen Exchange with Molecular Dynamics for Improved Ligand Binding Predictions. Walters, B.T., Patapoff, A.W., Kiefer, J.R. et al. J Chem Inf Model (2025) 65:6144-6154. DOI 10.1021/acs.jcim.5c00397 · PubMed
Other PDB entries of the same protein (UniProt P08515 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9N48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.