Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein. Determined by X-ray diffraction at 1.54 Å resolution. Released 4 Mar 2026.
Explore 9NL0 in 3D Show helices and sheets RCSB PDB PDBe
9NL0 contains 23 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 45-51 | 7 | 2 |
| α-helix | 52B-53 | 3 | |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 99 | 1 | 3 |
| β-strand | 100D | 1 | 3 |
| β-strand | 100H-103 | 4 | 2 |
| β-strand | 107-111 | 5 | 2 |
| β-strand | 117 | 1 | 4 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 5 |
| α-helix | 128-130 | 3 | |
| β-strand | 131-132 | 2 | 5 |
| β-strand | 135-145 | 11 | 5 |
| β-strand | 146 | 1 | 4 |
| β-strand | 151-154 | 4 | 6 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 6 |
| β-strand | 163-165 | 3 | 5 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 5 |
| β-strand | 176-185 | 10 | 5 |
| α-helix | 186-188 | 3 | |
| β-strand | 195-200 | 6 | 6 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 6 |
| α-helix | 212-214 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 7 |
| β-strand | 9-13 | 4 | 8 |
| β-strand | 18-24 | 7 | 7 |
| α-helix | 27C-29 | 3 | |
| α-helix | 31-33 | 3 | |
| β-strand | 34-38 | 5 | 8 |
| β-strand | 45-48 | 4 | 8 |
| β-strand | 49 | 1 | 9 |
| β-strand | 53 | 1 | 9 |
| α-helix | 54-55 | 2 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-76 | 7 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 8 |
| β-strand | 95B-98 | 4 | 8 |
| β-strand | 102-106 | 5 | 8 |
| β-strand | 111 | 1 | 10 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 11 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 130-139 | 10 | 11 |
| β-strand | 140 | 1 | 10 |
| β-strand | 145-150 | 6 | 12 |
| β-strand | 153-155 | 3 | 12 |
| β-strand | 159-161 | 3 | 11 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-166 | 2 | 11 |
| β-strand | 172-180 | 9 | 11 |
| α-helix | 182-186 | 5 | |
| β-strand | 191-197 | 7 | 12 |
| β-strand | 200-206 | 7 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heavy Chain of Fab MAM01 | H | protein | 230 | Homo sapiens | |
| Circumsporozoite protein | A | protein | 12 | Plasmodium falciparum 3D7 | Q7K740 (AlphaFold model) |
| Light Chain of Fab MAM01 | L | protein | 217 | Homo sapiens |
>9NL0_1 Heavy Chain of Fab MAM01 (chains H) EVQLVESGGGLVQPGRSLRLSCTASGFSFGDHAMSWVRQAPGKGLEWVGFIRKTTYGATT HYAAAVRGRFTISRDDSKSTVYLQMNSLKAEDTAVYFCARVQLDYGPGYQYYGMDVWGQG TTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>9NL0_2 Circumsporozoite protein (chains A) NPNANPNANPNA
>9NL0_3 Light Chain of Fab MAM01 (chains L) QSVLTQPPSVSGAPGQRVTISCTGMNSNIGAGYDVYWYQQLPGTAPKLLIYGNSNRPSGV PDRFSGSRSGTSASLAITGLQAEDEADYYCQSYDTSLNGWAFGGGTKLTVLGQPKAAPSV TLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS
Engineered antibodies preserve structural and functional recognition of Plasmodium falciparum circumsporozoite protein. Jain, M., Agrawal, S., Cannac, F. et al. Protein Sci (2026) 35:e70738-e70738. DOI 10.1002/pro.70738 · PubMed
Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9NL0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.