9OIK: S. Typhimurium 14028 Gifsy-1 prophage HepS

Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS bound to bacteriophage lambda J Tail Tip. Determined by X-ray diffraction at 1.86 Å resolution. Released 28 Jan 2026.

Method: X-ray diffraction
Resolution: 1.86 Å
Organisms: Salmonella enterica subsp. enterica serovar Typhimurium str. ATCC 14028, Escherichia phage Lambda
Chains: 4
Atoms: 4,239
Mol. weight: 86.83 kDa
Released: 28 Jan 2026

Explore 9OIK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OIK contains 33 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-3	3
β-strand	10-14	5	1
α-helix	24-27	4
α-helix	28-32	5
α-helix	36-58	23
α-helix	60	1
α-helix	73-82	10
α-helix	87-105	19
α-helix	113-124	12
α-helix	128-131	4
β-strand	137	1	2
α-helix	139-148	10
α-helix	149-152	4
β-strand	153	1	3
α-helix	154-156	3
α-helix	165-194	30
β-strand	200-206	7	1
α-helix	207	1
α-helix	209-210	2
α-helix	211-216	6

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	4
α-helix	24-27	4
α-helix	28-32	5
α-helix	36-58	23
α-helix	60	1
α-helix	73-82	10
α-helix	87-105	19
α-helix	113-123	11
α-helix	128-131	4
β-strand	137	1	5
α-helix	139-148	10
α-helix	149-152	4
β-strand	153	1	6
α-helix	154-157	4
α-helix	165-194	30
β-strand	200-206	7	4

Chain C: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	904	1	3
β-strand	913	1	3
β-strand	916-919	4	1
β-strand	922-926	5	1
α-helix	927-929	3
β-strand	930	1	2

Chain D: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	903	1
β-strand	904-905	2	6
α-helix	906	1
β-strand	912-913	2	6
β-strand	916-919	4	4
β-strand	922-926	5	4
α-helix	927-929	3
β-strand	930	1	5
α-helix	931-932	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HepS-H105A	A, B	protein	228	Salmonella enterica subsp. enterica serovar Typhimurium str. ATCC 14028	A0A0F6B549 (AlphaFold model)
J tail tip	C, D	protein	156	Escherichia phage Lambda	P03749, Q12306 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9OIK_1 HepS-H105A (chains A, B)
MGSMKYSRVEQSTGTSIDHNLGYFLDPQKYVPITEFVDESAALIKLNLIHENFLSIVIEN
LRREGTEKFVDVDKYFMPKIKTAVALGLPVSLAKCLTEMNNIRNKYAAKIEYIITDEDAE
RIDSLIMSVPVDDINHASLIDSTLITSITNLGASSIAFMNDIPKDFPDNRRRICKLVAMA
FCISNLGAFWLLNELHRQGKLKMGSTKMAFKPSAAASAAGDYKDDDDK

Sequence of entity 2 (C, D), FASTA

>9OIK_2 J tail tip (chains C, D)
MGHHHHHHHHHHSSGHIEGRHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIF
FKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI
GGSMIAFIDPANGNETPMFVAQGNQIFMNDVFLKRL

Primary citation

A prophage-encoded abortive infection protein preserves host and prophage spread. Sargen, M.R., Antine, S.P., Grabe, G.J. et al. Nature (2026) 652:201-208. DOI 10.1038/s41586-025-10070-6 · PubMed

Other PDB entries of the same protein (UniProt A0A0F6B549 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OIJ 2.05 Å, Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS

Browse structure collections

About this viewer

MolViewer shows 9OIK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.