Influenza A Virus Nucleoprotein(8-498)NP complex with 5-(4-(morpholinomethyl)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 3). Determined by X-ray diffraction at 2.73 Å resolution. Released 6 Aug 2025.
Explore 9OUC in 3D Show helices and sheets RCSB PDB PDBe
9OUC contains 50 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-47 | 26 | |
| α-helix | 51-54 | 4 | |
| β-strand | 56 | 1 | 1 |
| α-helix | 57-72 | 16 | |
| α-helix | 85-87 | 3 | |
| β-strand | 91-100 | 10 | 2 |
| β-strand | 103-112 | 10 | 2 |
| α-helix | 113-123 | 11 | |
| α-helix | 130-147 | 18 | |
| β-strand | 149 | 1 | 3 |
| α-helix | 151-157 | 7 | |
| α-helix | 161-166 | 6 | |
| α-helix | 177-183 | 7 | |
| α-helix | 186-202 | 17 | |
| α-helix | 209-229 | 21 | |
| α-helix | 233-244 | 12 | |
| α-helix | 250-263 | 14 | |
| α-helix | 278-286 | 9 | |
| α-helix | 291-294 | 4 | |
| α-helix | 301-308 | 8 | |
| β-strand | 313-316 | 4 | 1 |
| α-helix | 322-333 | 12 | |
| α-helix | 341-348 | 8 | |
| α-helix | 355-357 | 3 | |
| α-helix | 365-366 | 2 | |
| β-strand | 375-378 | 4 | 1 |
| β-strand | 385-386 | 2 | 4 |
| α-helix | 441-449 | 9 | |
| β-strand | 463 | 1 | 5 |
| β-strand | 464-465 | 2 | 4 |
| α-helix | 474 | 1 | |
| β-strand | 475 | 1 | 5 |
| α-helix | 476-477 | 2 | |
| α-helix | 493-494 | 2 | |
| β-strand | 495 | 1 | 3 |
| α-helix | 496 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-47 | 26 | |
| α-helix | 51-54 | 4 | |
| β-strand | 56 | 1 | 6 |
| α-helix | 57-72 | 16 | |
| β-strand | 91-100 | 10 | 7 |
| β-strand | 103-112 | 10 | 7 |
| α-helix | 113-123 | 11 | |
| α-helix | 130-147 | 18 | |
| β-strand | 149 | 1 | 8 |
| α-helix | 151-156 | 6 | |
| α-helix | 161-166 | 6 | |
| α-helix | 177-181 | 5 | |
| α-helix | 186-202 | 17 | |
| α-helix | 209-229 | 21 | |
| β-strand | 230 | 1 | 9 |
| α-helix | 233-244 | 12 | |
| α-helix | 250-262 | 13 | |
| β-strand | 268 | 1 | 9 |
| α-helix | 278-286 | 9 | |
| α-helix | 291-294 | 4 | |
| α-helix | 301-308 | 8 | |
| β-strand | 313-316 | 4 | 6 |
| α-helix | 322-333 | 12 | |
| α-helix | 341-348 | 8 | |
| α-helix | 355-357 | 3 | |
| α-helix | 365-366 | 2 | |
| β-strand | 375-378 | 4 | 6 |
| β-strand | 386 | 1 | 10 |
| α-helix | 440-448 | 10 | |
| α-helix | 452-454 | 3 | |
| β-strand | 463 | 1 | 11 |
| β-strand | 464 | 1 | 10 |
| α-helix | 474 | 1 | |
| β-strand | 475 | 1 | 11 |
| α-helix | 476-477 | 2 | |
| α-helix | 493-494 | 2 | |
| β-strand | 495 | 1 | 8 |
| α-helix | 496 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nucleoprotein | A, B | protein | 498 | Influenza A virus (A/(Puerto Rico/8/1934-Korea/426/1968)(H2N2)) | S5G2J2 |
>9OUC_1 Nucleoprotein (chains A, B) MRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERM VLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNG DDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGV GTMVMELVRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESR NPGNAEFEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVGIDPFRL LQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGTKVLPRGKLSTRGVQIA SNENMETMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPFDRTTIM AAFNGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGS YFFGDNAEEYDNHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| A1CEM | 5-{4-[(morpholin-4-yl)methyl]phenyl}-2-oxo-6-(trifluoromethyl)-1,2-dihydropyrid… | C18 H18 F3 N3 O3 | 2 |
Discovery and Optimization of a Novel Series of Influenza A Virus Replication Inhibitors Targeting the Nucleoprotein Protein-Protein Interaction. Taft, B.R., Hesse, M.J., Mamo, M. et al. J Med Chem (2025) 68:16349-16370. DOI 10.1021/acs.jmedchem.5c01233 · PubMed
Other PDB entries of the same protein (UniProt S5G2J2), best resolution first:
MolViewer shows 9OUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.