9OUN: Gamma-aminobutyric acid receptor subunit gamma-2

Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029. Determined by electron microscopy at 2.74 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 2.74 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 9
Atoms: 12,383
Mol. weight: 368.08 kDa
Ligands: NAG, ABU, A1CEP
Released: 18 Feb 2026

Explore 9OUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OUN contains 30 α-helices and 113 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
β-strand	38-53	16	9
β-strand	58-70	13	9
β-strand	82-85	4	9
α-helix	87-90	4
β-strand	98-100	3	10
β-strand	103	1	9
β-strand	107-108	2	9
β-strand	112	1	11
β-strand	116-121	6	9
β-strand	125-137	13	9
β-strand	149-158	10	10
β-strand	166-170	5	9
α-helix	174-176	3
β-strand	178-180	3	9
β-strand	185	1	9
β-strand	190-204	15	10
β-strand	207-220	14	10

Chain B: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	12
β-strand	56-68	13	12
α-helix	70-72	3
β-strand	81-83	3	12
α-helix	85-90	6
β-strand	96-98	3	13
β-strand	101-106	6	12
β-strand	114-118	5	12
β-strand	123-135	13	12
β-strand	147-156	10	13
β-strand	164-168	5	12
β-strand	175-176	2	12
β-strand	186-200	15	13
β-strand	203-216	14	13

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
α-helix	37	1
β-strand	38-53	16	14
β-strand	58-70	13	14
β-strand	82-85	4	14
α-helix	87-92	6
β-strand	98-100	3	15
β-strand	103	1	14
β-strand	107-108	2	14
β-strand	116-121	6	14
β-strand	125-137	13	14
β-strand	149-158	10	15
β-strand	166-170	5	14
α-helix	174-176	3
β-strand	178-180	3	14
β-strand	185	1	14
β-strand	190-204	15	15
β-strand	207-220	14	15

Chain D: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	26-34	9
α-helix	50	1
β-strand	51-66	16	1
β-strand	71-83	13	1
β-strand	95-98	4	1
α-helix	100-105	6
β-strand	111-113	3	2
β-strand	116-121	6	1
β-strand	129-134	6	1
β-strand	138-149	12	1
β-strand	162-163	2	2
β-strand	166-171	6	2
β-strand	179-182	4	1
β-strand	188-190	3	1
β-strand	201-214	14	2
β-strand	219-231	13	2

Chain E: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	16
β-strand	56-68	13	16
α-helix	70-72	3
β-strand	81-83	3	16
α-helix	85-90	6
β-strand	96-98	3	11
β-strand	101-106	6	16
β-strand	114-118	5	16
β-strand	123-135	13	16
β-strand	149-156	8	11
β-strand	164-168	5	16
α-helix	171-173	3
β-strand	175-176	2	16
α-helix	178-180	3
β-strand	186-200	15	11
β-strand	203-216	14	11

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	3
β-strand	10-12	3	4
β-strand	18-25	8	3
α-helix	29-31	3
β-strand	34-39	6	4
β-strand	45-51	7	4
β-strand	57-59	3	4
β-strand	64	1	3
β-strand	67-72	6	3
β-strand	77-82	6	3
α-helix	84-86	3
β-strand	88-95	8	4
β-strand	100A-103	4	4
β-strand	107-111	5	4

Chain J: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	5
β-strand	10-12	3	6
β-strand	18-23	6	5
α-helix	29-31	3
β-strand	34-39	6	6
β-strand	45-51	7	6
β-strand	57-59	3	6
α-helix	61-63	3
β-strand	64	1	5
β-strand	67-72	6	5
β-strand	77-82	6	5
α-helix	84-86	3
β-strand	88-95	8	6
β-strand	100A-103	4	6
β-strand	107-111	5	6

Chain K: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	17
β-strand	10-12	3	18
β-strand	19-25	7	17
β-strand	33-38	6	18
β-strand	45-49	5	18
β-strand	53-54	2	18
α-helix	55	1
β-strand	62-66	5	17
β-strand	70-75	6	17
β-strand	85-90	6	18
β-strand	96-97	2	18
β-strand	101-104	4	18

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit gamma-2	D	protein	466	Rattus norvegicus	P18508 (AlphaFold model)
8E3 Fab heavy chain	H, J	protein	223	Mus musculus
8E3 Fab light chain	K, L	protein	213	Mus musculus
Gamma-aminobutyric acid receptor subunit alpha-1	A, C	protein	455	Rattus norvegicus	P62813 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-2	B, E	protein	474	Rattus norvegicus	P63138 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>9OUN_1 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSTGSTVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCF
EDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 2 (H, J), FASTA

>9OUN_2 8E3 Fab heavy chain (chains H, J)
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNMYWVKQSHGKSLEWIGYIDPYNADTTY
NREFKGKATLTVDKSSSTAFMHLNSLTSEDSAVYYCARKRNNFYFDYWGQGTPLTVSSAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKSAALEVLFQ

Sequence of entity 3 (K, L), FASTA

>9OUN_3 8E3 Fab light chain (chains K, L)
YIVMTQSPKSMSMSLGERVTLSCRASEYVGSYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFAGSGSATDFTLTITSVQAEDLADYHCGQTYNYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 4 (A, C), FASTA

>9OUN_4 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, C)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 5 (B, E), FASTA

>9OUN_5 Gamma-aminobutyric acid receptor subunit beta-2 (chains B, E)
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
DPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALER
HVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
A1CEP	7-methoxy-2-(4-methoxyphenyl)-1,2-dihydro-3H-pyrazolo[4,3-c]quinolin-3-one	C18 H15 N3 O3	1

Primary citation

Molecular assemblies and pharmacology of cerebellar GABA A receptors. Sun, C., Jahncke, J.N., Wright, K.M. et al. Proc Natl Acad Sci U S A (2026) 123:e2524504123-e2524504123. DOI 10.1073/pnas.2524504123 · PubMed

Other PDB entries of the same protein (UniProt P18508 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
9OUP 2.82 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUR 2.84 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUQ 2.89 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUM 2.9 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUO 2.92 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in…
9OV4 2.93 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
6DW1 3.1 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…
6DW0 3.8 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…

Browse structure collections

About this viewer

MolViewer shows 9OUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.